Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165UG40

Protein Details
Accession A0A165UG40    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
10-31LPETEKRRHKLKRLVQSPNSYFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto 8.5, mito_nucl 7.833, cyto_nucl 6.333, cyto_pero 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR000592  Ribosomal_S27  
IPR023407  Ribosomal_S27_Zn-bd_dom_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0046872  F:metal ion binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01667  Ribosomal_S27e  
PROSITE View protein in PROSITE  
PS01168  RIBOSOMAL_S27E  
Amino Acid Sequences TLAVDLLNPLPETEKRRHKLKRLVQSPNSYFMDVKCPGCFTITTVFSHAQTVVLCGACASVLCQPTGGKARLTEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.43
3 0.53
4 0.61
5 0.67
6 0.73
7 0.78
8 0.8
9 0.79
10 0.83
11 0.81
12 0.81
13 0.73
14 0.69
15 0.62
16 0.52
17 0.43
18 0.33
19 0.32
20 0.25
21 0.24
22 0.18
23 0.17
24 0.16
25 0.16
26 0.16
27 0.11
28 0.14
29 0.15
30 0.15
31 0.17
32 0.18
33 0.17
34 0.18
35 0.16
36 0.12
37 0.1
38 0.11
39 0.1
40 0.09
41 0.08
42 0.07
43 0.07
44 0.06
45 0.06
46 0.07
47 0.09
48 0.1
49 0.1
50 0.12
51 0.12
52 0.17
53 0.24
54 0.25
55 0.23