Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165QTP5

Protein Details
Accession A0A165QTP5    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-42ALTLSGKMHTRRKKPQKNENLRWRPTCTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MQGYWSMISWTVATALTLSGKMHTRRKKPQKNENLRWRPTCTCARLLRPQPACRCLRCLPLSRSKPSVAGPGMASSVYKSPAFSALSSGSSRPRHPSHSFAVESPLTLFHPSPCSSPRLSFPSPSLCLRWQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.08
6 0.1
7 0.16
8 0.22
9 0.32
10 0.4
11 0.48
12 0.59
13 0.7
14 0.78
15 0.83
16 0.88
17 0.89
18 0.92
19 0.93
20 0.93
21 0.92
22 0.89
23 0.83
24 0.78
25 0.69
26 0.64
27 0.61
28 0.53
29 0.5
30 0.48
31 0.5
32 0.53
33 0.55
34 0.58
35 0.57
36 0.61
37 0.58
38 0.6
39 0.58
40 0.51
41 0.52
42 0.45
43 0.46
44 0.43
45 0.44
46 0.42
47 0.48
48 0.52
49 0.49
50 0.5
51 0.43
52 0.41
53 0.34
54 0.34
55 0.24
56 0.2
57 0.17
58 0.15
59 0.14
60 0.12
61 0.11
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.11
69 0.12
70 0.12
71 0.13
72 0.13
73 0.15
74 0.16
75 0.16
76 0.2
77 0.22
78 0.23
79 0.28
80 0.3
81 0.35
82 0.38
83 0.42
84 0.41
85 0.45
86 0.45
87 0.39
88 0.41
89 0.34
90 0.3
91 0.26
92 0.21
93 0.15
94 0.16
95 0.16
96 0.13
97 0.17
98 0.18
99 0.21
100 0.23
101 0.25
102 0.26
103 0.29
104 0.33
105 0.36
106 0.38
107 0.38
108 0.4
109 0.44
110 0.45
111 0.45