Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165LKE6

Protein Details
Accession A0A165LKE6    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
29-48AYRKLSLKVHPDRNRGNPDAHydrophilic
NLS Segment(s)
PositionSequence
77-87LKEARKARFAS
89-96DAKRKGLV
98-146ELEARERAFKKARVEKQEEERARWRENERIMDEGRRLREEKEKALRKRE
211-219PAPPKRPKR
Subcellular Location(s) nucl 15.5, cyto_nucl 13.5, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MSVADEEEVNPYELLGVTIESTEQDIRTAYRKLSLKVHPDRNRGNPDAARKFHELNQAYELLLDPLRRMALDAKVRLKEARKARFASYDAKRKGLVEELEARERAFKKARVEKQEEERARWRENERIMDEGRRLREEKEKALRKREEEALRGERDAAREDEPPELGDLDTTIRLKYPLSAHPSLTTPASLVALLSPFGAVDEASIKLILKPAPPKRPKRGIALVPFKQIGGAFAAVCASGRAESGLVDVEVGWAEDKEPELIGWLKKKGQLGAGGESGATKGGNEQGKQDSAPQPTPGNAEPSSTSTAPSDTTSATPFSSFPSTFPSLDASTDPSAKQPQIGLDYESLTLMRMRHAERARMEREIREREAAEGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.08
4 0.07
5 0.07
6 0.07
7 0.07
8 0.09
9 0.1
10 0.1
11 0.11
12 0.11
13 0.14
14 0.18
15 0.21
16 0.2
17 0.26
18 0.31
19 0.34
20 0.41
21 0.47
22 0.52
23 0.59
24 0.69
25 0.7
26 0.75
27 0.79
28 0.8
29 0.8
30 0.73
31 0.71
32 0.66
33 0.67
34 0.67
35 0.63
36 0.59
37 0.55
38 0.54
39 0.52
40 0.56
41 0.48
42 0.42
43 0.43
44 0.39
45 0.34
46 0.31
47 0.26
48 0.18
49 0.17
50 0.14
51 0.1
52 0.11
53 0.11
54 0.11
55 0.12
56 0.13
57 0.19
58 0.26
59 0.32
60 0.37
61 0.39
62 0.41
63 0.44
64 0.45
65 0.45
66 0.48
67 0.51
68 0.52
69 0.53
70 0.55
71 0.55
72 0.54
73 0.55
74 0.55
75 0.56
76 0.51
77 0.5
78 0.48
79 0.43
80 0.42
81 0.38
82 0.31
83 0.25
84 0.31
85 0.32
86 0.35
87 0.34
88 0.32
89 0.32
90 0.32
91 0.33
92 0.31
93 0.32
94 0.38
95 0.48
96 0.56
97 0.59
98 0.65
99 0.66
100 0.69
101 0.75
102 0.68
103 0.64
104 0.64
105 0.6
106 0.55
107 0.54
108 0.49
109 0.45
110 0.48
111 0.49
112 0.43
113 0.42
114 0.41
115 0.38
116 0.39
117 0.37
118 0.34
119 0.3
120 0.3
121 0.28
122 0.35
123 0.36
124 0.4
125 0.46
126 0.53
127 0.56
128 0.64
129 0.66
130 0.61
131 0.62
132 0.61
133 0.56
134 0.5
135 0.51
136 0.47
137 0.43
138 0.4
139 0.36
140 0.29
141 0.26
142 0.25
143 0.2
144 0.16
145 0.17
146 0.18
147 0.17
148 0.16
149 0.15
150 0.13
151 0.11
152 0.09
153 0.07
154 0.06
155 0.06
156 0.07
157 0.07
158 0.07
159 0.07
160 0.07
161 0.07
162 0.1
163 0.12
164 0.16
165 0.23
166 0.24
167 0.24
168 0.25
169 0.26
170 0.24
171 0.21
172 0.16
173 0.09
174 0.08
175 0.08
176 0.06
177 0.05
178 0.05
179 0.04
180 0.04
181 0.04
182 0.04
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.04
189 0.04
190 0.05
191 0.05
192 0.05
193 0.05
194 0.08
195 0.09
196 0.11
197 0.19
198 0.26
199 0.37
200 0.45
201 0.53
202 0.61
203 0.69
204 0.69
205 0.69
206 0.7
207 0.67
208 0.67
209 0.68
210 0.62
211 0.55
212 0.52
213 0.44
214 0.36
215 0.29
216 0.2
217 0.12
218 0.1
219 0.07
220 0.07
221 0.07
222 0.06
223 0.06
224 0.06
225 0.04
226 0.04
227 0.04
228 0.04
229 0.04
230 0.04
231 0.05
232 0.05
233 0.05
234 0.05
235 0.05
236 0.05
237 0.04
238 0.05
239 0.04
240 0.04
241 0.04
242 0.05
243 0.06
244 0.06
245 0.06
246 0.06
247 0.08
248 0.11
249 0.14
250 0.18
251 0.2
252 0.22
253 0.26
254 0.28
255 0.27
256 0.27
257 0.3
258 0.28
259 0.29
260 0.27
261 0.24
262 0.21
263 0.2
264 0.17
265 0.12
266 0.08
267 0.05
268 0.05
269 0.11
270 0.15
271 0.16
272 0.19
273 0.22
274 0.24
275 0.25
276 0.29
277 0.3
278 0.31
279 0.33
280 0.32
281 0.3
282 0.3
283 0.34
284 0.29
285 0.29
286 0.24
287 0.24
288 0.23
289 0.25
290 0.28
291 0.24
292 0.24
293 0.19
294 0.2
295 0.19
296 0.19
297 0.17
298 0.13
299 0.15
300 0.16
301 0.16
302 0.16
303 0.16
304 0.14
305 0.17
306 0.21
307 0.2
308 0.19
309 0.24
310 0.28
311 0.27
312 0.28
313 0.28
314 0.23
315 0.24
316 0.25
317 0.22
318 0.21
319 0.23
320 0.22
321 0.23
322 0.27
323 0.26
324 0.27
325 0.24
326 0.25
327 0.28
328 0.29
329 0.28
330 0.24
331 0.25
332 0.24
333 0.22
334 0.18
335 0.14
336 0.15
337 0.12
338 0.14
339 0.18
340 0.2
341 0.29
342 0.34
343 0.41
344 0.46
345 0.54
346 0.55
347 0.58
348 0.59
349 0.59
350 0.63
351 0.63
352 0.6
353 0.57
354 0.53