Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165SI95

Protein Details
Accession A0A165SI95   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
77-103YGSEYQPSQRKRKRKHGFLARKRSLNGHydrophilic
NLS Segment(s)
PositionSequence
86-116RKRKRKHGFLARKRSLNGQKILLRRRARGRL
Subcellular Location(s) mito 13, nucl 12, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRIPFQLLRLLARPPTLSLLPSRPTSFHSMVTTALPRSVPSLLSNSRILGYLQLLPSLCAPSPILHTLQQVRYRTYGSEYQPSQRKRKRKHGFLARKRSLNGQKILLRRRARGRLHLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.25
4 0.23
5 0.22
6 0.22
7 0.25
8 0.26
9 0.29
10 0.29
11 0.26
12 0.28
13 0.34
14 0.32
15 0.3
16 0.28
17 0.26
18 0.25
19 0.26
20 0.25
21 0.18
22 0.17
23 0.14
24 0.13
25 0.14
26 0.13
27 0.12
28 0.11
29 0.16
30 0.16
31 0.19
32 0.2
33 0.18
34 0.18
35 0.17
36 0.16
37 0.12
38 0.11
39 0.11
40 0.1
41 0.11
42 0.1
43 0.1
44 0.1
45 0.11
46 0.09
47 0.07
48 0.08
49 0.07
50 0.1
51 0.11
52 0.12
53 0.12
54 0.15
55 0.18
56 0.22
57 0.28
58 0.27
59 0.27
60 0.27
61 0.27
62 0.25
63 0.26
64 0.27
65 0.24
66 0.29
67 0.29
68 0.35
69 0.42
70 0.48
71 0.54
72 0.57
73 0.64
74 0.67
75 0.76
76 0.8
77 0.82
78 0.87
79 0.87
80 0.91
81 0.91
82 0.93
83 0.9
84 0.84
85 0.75
86 0.75
87 0.73
88 0.69
89 0.63
90 0.59
91 0.58
92 0.61
93 0.68
94 0.67
95 0.63
96 0.63
97 0.68
98 0.7
99 0.7
100 0.72