Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165QBM7

Protein Details
Accession A0A165QBM7   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
37-56PGNAVKKRPRRRYDEIERLYBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences GQAAVGQGGGQGQGPPPGAQTQQRSANGKTYSFVSLPGNAVKKRPRRRYDEIERLYQCSWPNCTKAYGTLNHLNAHVTMQKHGPKRSPGEFKELRKQWRQTKKEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.13
4 0.15
5 0.17
6 0.22
7 0.27
8 0.3
9 0.36
10 0.42
11 0.44
12 0.43
13 0.48
14 0.44
15 0.4
16 0.35
17 0.29
18 0.27
19 0.23
20 0.23
21 0.17
22 0.16
23 0.17
24 0.2
25 0.22
26 0.2
27 0.25
28 0.31
29 0.39
30 0.48
31 0.57
32 0.6
33 0.64
34 0.72
35 0.77
36 0.79
37 0.8
38 0.73
39 0.7
40 0.64
41 0.58
42 0.5
43 0.43
44 0.35
45 0.26
46 0.28
47 0.23
48 0.24
49 0.22
50 0.23
51 0.21
52 0.23
53 0.25
54 0.23
55 0.26
56 0.31
57 0.32
58 0.31
59 0.31
60 0.27
61 0.23
62 0.23
63 0.2
64 0.15
65 0.15
66 0.19
67 0.26
68 0.31
69 0.36
70 0.4
71 0.43
72 0.5
73 0.57
74 0.61
75 0.57
76 0.61
77 0.64
78 0.65
79 0.69
80 0.69
81 0.69
82 0.68
83 0.75
84 0.76
85 0.79