Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165SPW4

Protein Details
Accession A0A165SPW4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
87-109ASSARRTGPPTPRRRARLVRPMPHydrophilic
NLS Segment(s)
PositionSequence
91-106RRTGPPTPRRRARLVR
Subcellular Location(s) nucl 17, cyto 4, extr 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MQLACVQVFCQAPLPSCTCAAASDRTRPFPKSTPPTPSSLSTVIPSRALCNTLTNRRRFSSHCPRIARDCDGLREWRTSDARRPTSASSARRTGPPTPRRRARLVRPMP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.24
4 0.24
5 0.19
6 0.19
7 0.19
8 0.23
9 0.23
10 0.31
11 0.33
12 0.39
13 0.42
14 0.43
15 0.45
16 0.43
17 0.49
18 0.49
19 0.51
20 0.53
21 0.52
22 0.54
23 0.51
24 0.48
25 0.42
26 0.36
27 0.31
28 0.24
29 0.24
30 0.21
31 0.19
32 0.17
33 0.15
34 0.14
35 0.14
36 0.13
37 0.15
38 0.19
39 0.28
40 0.34
41 0.36
42 0.39
43 0.39
44 0.41
45 0.4
46 0.45
47 0.46
48 0.48
49 0.53
50 0.53
51 0.55
52 0.59
53 0.59
54 0.53
55 0.47
56 0.4
57 0.35
58 0.35
59 0.36
60 0.32
61 0.3
62 0.28
63 0.28
64 0.32
65 0.31
66 0.37
67 0.43
68 0.45
69 0.45
70 0.47
71 0.44
72 0.48
73 0.53
74 0.5
75 0.46
76 0.47
77 0.47
78 0.48
79 0.49
80 0.49
81 0.51
82 0.56
83 0.6
84 0.66
85 0.73
86 0.75
87 0.8
88 0.82
89 0.82