Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2X776

Protein Details
Accession G2X776    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
325-346RFCPRFLRRALRMRRMPRDQTVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR038770  Na+/solute_symporter_sf  
IPR016833  Put_Na-Bile_cotransptr  
Gene Ontology GO:0016020  C:membrane  
KEGG vda:VDAG_06334  -  
Pfam View protein in Pfam  
PF13593  SBF_like  
Amino Acid Sequences MPEDIEHQNGQHEAHAEHGFRDTSGRDGAPAEVKREDDGEGDVGRAPKPPWRRVVGFILAQWLIIGFGVACLFAYFWPHVAAKGGPIRSEYSIIYGAIAVVFLISGLQLSPVKLREHATNWRLHLLVQGISFVAIPVVLLVVLHVSVAAGALRDGVLDTSVFVGMLVTACLPTTIASNVVMTRCAGGDDAAHIIETPPFAPWQPASPSTLGPMYAGVLRQLGLTVLLPLAAGQIVRRFFDAPVSRALRVLRLAKLSGVCLVLLIWTTFSGAFHTGALQDTPPASIIFTVFMNLALYALFTVLCFVAARPPLALARPVNARVADGRFCPRFLRRALRMRRMPRDQTVAVCFCGAAKTTSLGIPLVAAMWRDADDLTVALVQVPLLLYTIEQVFVAQGLVYFFRWYLDRPPAEGEADDAEKQPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.23
4 0.23
5 0.25
6 0.23
7 0.21
8 0.23
9 0.19
10 0.18
11 0.21
12 0.2
13 0.18
14 0.19
15 0.21
16 0.27
17 0.28
18 0.28
19 0.27
20 0.28
21 0.28
22 0.28
23 0.26
24 0.19
25 0.19
26 0.18
27 0.16
28 0.16
29 0.17
30 0.18
31 0.17
32 0.19
33 0.18
34 0.23
35 0.32
36 0.38
37 0.43
38 0.48
39 0.52
40 0.54
41 0.6
42 0.58
43 0.52
44 0.45
45 0.42
46 0.35
47 0.31
48 0.25
49 0.17
50 0.11
51 0.09
52 0.08
53 0.03
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.08
62 0.08
63 0.09
64 0.12
65 0.12
66 0.13
67 0.15
68 0.15
69 0.17
70 0.23
71 0.23
72 0.21
73 0.23
74 0.25
75 0.25
76 0.26
77 0.21
78 0.18
79 0.18
80 0.17
81 0.15
82 0.13
83 0.11
84 0.09
85 0.08
86 0.05
87 0.03
88 0.03
89 0.02
90 0.02
91 0.02
92 0.02
93 0.02
94 0.05
95 0.06
96 0.07
97 0.09
98 0.13
99 0.14
100 0.16
101 0.19
102 0.21
103 0.26
104 0.35
105 0.37
106 0.39
107 0.39
108 0.4
109 0.37
110 0.33
111 0.31
112 0.23
113 0.21
114 0.16
115 0.14
116 0.11
117 0.12
118 0.11
119 0.08
120 0.06
121 0.04
122 0.03
123 0.03
124 0.03
125 0.02
126 0.02
127 0.02
128 0.02
129 0.03
130 0.02
131 0.02
132 0.02
133 0.02
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.04
144 0.03
145 0.04
146 0.04
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.04
160 0.05
161 0.05
162 0.06
163 0.06
164 0.07
165 0.08
166 0.08
167 0.08
168 0.07
169 0.07
170 0.07
171 0.07
172 0.06
173 0.05
174 0.05
175 0.05
176 0.06
177 0.06
178 0.05
179 0.05
180 0.05
181 0.06
182 0.06
183 0.05
184 0.05
185 0.05
186 0.06
187 0.07
188 0.07
189 0.1
190 0.12
191 0.13
192 0.15
193 0.15
194 0.15
195 0.15
196 0.15
197 0.12
198 0.1
199 0.09
200 0.07
201 0.07
202 0.06
203 0.06
204 0.05
205 0.05
206 0.05
207 0.05
208 0.04
209 0.04
210 0.04
211 0.04
212 0.04
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.07
221 0.08
222 0.08
223 0.09
224 0.1
225 0.1
226 0.17
227 0.2
228 0.18
229 0.24
230 0.26
231 0.26
232 0.27
233 0.27
234 0.22
235 0.22
236 0.24
237 0.2
238 0.19
239 0.19
240 0.19
241 0.19
242 0.18
243 0.15
244 0.13
245 0.1
246 0.08
247 0.08
248 0.06
249 0.06
250 0.06
251 0.04
252 0.04
253 0.05
254 0.05
255 0.05
256 0.06
257 0.07
258 0.08
259 0.07
260 0.08
261 0.08
262 0.08
263 0.09
264 0.07
265 0.07
266 0.07
267 0.07
268 0.07
269 0.07
270 0.07
271 0.06
272 0.07
273 0.07
274 0.07
275 0.07
276 0.06
277 0.06
278 0.07
279 0.06
280 0.06
281 0.04
282 0.05
283 0.04
284 0.04
285 0.04
286 0.03
287 0.04
288 0.04
289 0.04
290 0.05
291 0.05
292 0.1
293 0.11
294 0.12
295 0.11
296 0.12
297 0.13
298 0.14
299 0.19
300 0.14
301 0.17
302 0.21
303 0.22
304 0.23
305 0.22
306 0.22
307 0.22
308 0.24
309 0.23
310 0.22
311 0.28
312 0.26
313 0.27
314 0.31
315 0.31
316 0.34
317 0.38
318 0.44
319 0.46
320 0.55
321 0.64
322 0.7
323 0.76
324 0.79
325 0.83
326 0.82
327 0.8
328 0.76
329 0.74
330 0.66
331 0.61
332 0.58
333 0.5
334 0.42
335 0.35
336 0.29
337 0.22
338 0.21
339 0.17
340 0.11
341 0.1
342 0.11
343 0.12
344 0.13
345 0.14
346 0.13
347 0.12
348 0.1
349 0.09
350 0.08
351 0.08
352 0.08
353 0.07
354 0.08
355 0.08
356 0.09
357 0.09
358 0.08
359 0.08
360 0.08
361 0.08
362 0.08
363 0.07
364 0.07
365 0.07
366 0.06
367 0.06
368 0.06
369 0.05
370 0.05
371 0.06
372 0.05
373 0.07
374 0.08
375 0.08
376 0.07
377 0.07
378 0.07
379 0.07
380 0.08
381 0.06
382 0.06
383 0.07
384 0.08
385 0.09
386 0.1
387 0.1
388 0.11
389 0.13
390 0.15
391 0.21
392 0.29
393 0.31
394 0.32
395 0.37
396 0.38
397 0.38
398 0.36
399 0.31
400 0.25
401 0.26
402 0.25