Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165KPK4

Protein Details
Accession A0A165KPK4    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
57-77AEEQRDAKKRRKPNAYRCAREBasic
NLS Segment(s)
PositionSequence
64-68KKRRK
Subcellular Location(s) nucl 16, cyto 5, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002893  Znf_MYND  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF01753  zf-MYND  
Amino Acid Sequences MSRPMRILQMGLGRIPDDFDFGDTKSLDEVNDLLRYYQVYSSAVPLERRRCIVMKWAEEQRDAKKRRKPNAYRCAREGCPVQATSQAALKRCGGPCPEEYKPYYCSKECQLQDRTIHKTGKAHLTSSMQTIMATRPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.17
4 0.13
5 0.11
6 0.12
7 0.13
8 0.13
9 0.16
10 0.15
11 0.15
12 0.14
13 0.14
14 0.12
15 0.11
16 0.12
17 0.11
18 0.13
19 0.12
20 0.11
21 0.11
22 0.12
23 0.12
24 0.12
25 0.11
26 0.1
27 0.11
28 0.12
29 0.14
30 0.16
31 0.18
32 0.23
33 0.26
34 0.27
35 0.28
36 0.29
37 0.28
38 0.27
39 0.32
40 0.34
41 0.32
42 0.35
43 0.38
44 0.37
45 0.38
46 0.41
47 0.39
48 0.42
49 0.43
50 0.46
51 0.49
52 0.56
53 0.63
54 0.71
55 0.73
56 0.75
57 0.81
58 0.83
59 0.79
60 0.74
61 0.71
62 0.61
63 0.54
64 0.46
65 0.37
66 0.3
67 0.27
68 0.23
69 0.21
70 0.21
71 0.18
72 0.19
73 0.19
74 0.18
75 0.19
76 0.2
77 0.22
78 0.22
79 0.25
80 0.22
81 0.24
82 0.26
83 0.31
84 0.32
85 0.31
86 0.33
87 0.33
88 0.35
89 0.39
90 0.4
91 0.35
92 0.36
93 0.37
94 0.44
95 0.43
96 0.48
97 0.46
98 0.47
99 0.53
100 0.57
101 0.58
102 0.56
103 0.56
104 0.5
105 0.5
106 0.49
107 0.52
108 0.47
109 0.42
110 0.39
111 0.41
112 0.4
113 0.38
114 0.34
115 0.24
116 0.22
117 0.22