Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165PQX2

Protein Details
Accession A0A165PQX2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
86-105GRCFRAPRLRYRQSRCTACCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, cyto 9, plas 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045340  DUF6533  
Pfam View protein in Pfam  
PF20151  DUF6533  
Amino Acid Sequences MVCVSVTSSAVALLLYEHIITLGQESRFVWTDICAGHAVIFIVNRLNMVSMSVDIILSLHTWRTIMLQGGSNTGAVHLRERVSLVGRCFRAPRLRYRQSRCTACCAHRSACFGPCRSQHCKPSSSTSDPNSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.05
6 0.05
7 0.05
8 0.07
9 0.11
10 0.1
11 0.12
12 0.12
13 0.15
14 0.17
15 0.17
16 0.15
17 0.12
18 0.14
19 0.13
20 0.15
21 0.11
22 0.1
23 0.1
24 0.1
25 0.09
26 0.07
27 0.07
28 0.06
29 0.07
30 0.06
31 0.06
32 0.06
33 0.06
34 0.05
35 0.06
36 0.06
37 0.05
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.06
51 0.06
52 0.07
53 0.07
54 0.1
55 0.1
56 0.11
57 0.11
58 0.1
59 0.09
60 0.09
61 0.09
62 0.07
63 0.08
64 0.09
65 0.09
66 0.09
67 0.1
68 0.11
69 0.13
70 0.16
71 0.17
72 0.22
73 0.22
74 0.24
75 0.25
76 0.28
77 0.34
78 0.34
79 0.42
80 0.46
81 0.55
82 0.63
83 0.7
84 0.75
85 0.75
86 0.81
87 0.73
88 0.71
89 0.68
90 0.63
91 0.62
92 0.57
93 0.52
94 0.47
95 0.5
96 0.45
97 0.45
98 0.46
99 0.42
100 0.44
101 0.47
102 0.5
103 0.52
104 0.57
105 0.6
106 0.6
107 0.62
108 0.59
109 0.62
110 0.63
111 0.63
112 0.62