Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165QIV9

Protein Details
Accession A0A165QIV9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
124-158DDVLAEKRKPRRLKDGRRKLKPRRGVAKRLQDITCBasic
NLS Segment(s)
PositionSequence
130-152KRKPRRLKDGRRKLKPRRGVAKR
Subcellular Location(s) cyto 13.5cyto_nucl 13.5, nucl 12.5
Family & Domain DBs
Amino Acid Sequences MPTNIELAIASVMYKHKELTVHNVLVDYLRIIGYIEPGQKEVTVPHDAVVAFEHALDKEPLLRKRCGALDAALCTRMYTKEITELRREYWKEKLGSSSPVRCTCPTCGCTVAYEKDPEVVEGEDDVLAEKRKPRRLKDGRRKLKPRRGVAKRLQDITCANIPFDPYGPSTSASVM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.15
4 0.19
5 0.21
6 0.28
7 0.33
8 0.33
9 0.32
10 0.32
11 0.3
12 0.27
13 0.25
14 0.16
15 0.09
16 0.07
17 0.07
18 0.07
19 0.07
20 0.09
21 0.12
22 0.15
23 0.15
24 0.16
25 0.16
26 0.16
27 0.16
28 0.15
29 0.16
30 0.16
31 0.15
32 0.14
33 0.16
34 0.16
35 0.16
36 0.15
37 0.12
38 0.09
39 0.09
40 0.09
41 0.07
42 0.09
43 0.09
44 0.08
45 0.12
46 0.18
47 0.24
48 0.28
49 0.29
50 0.28
51 0.32
52 0.33
53 0.29
54 0.24
55 0.21
56 0.19
57 0.21
58 0.2
59 0.18
60 0.16
61 0.15
62 0.14
63 0.12
64 0.11
65 0.09
66 0.09
67 0.16
68 0.19
69 0.22
70 0.26
71 0.26
72 0.27
73 0.33
74 0.34
75 0.28
76 0.31
77 0.34
78 0.3
79 0.3
80 0.32
81 0.27
82 0.32
83 0.34
84 0.33
85 0.33
86 0.34
87 0.36
88 0.33
89 0.35
90 0.33
91 0.35
92 0.31
93 0.28
94 0.27
95 0.24
96 0.25
97 0.26
98 0.24
99 0.2
100 0.2
101 0.18
102 0.19
103 0.19
104 0.18
105 0.15
106 0.13
107 0.11
108 0.09
109 0.1
110 0.07
111 0.07
112 0.07
113 0.07
114 0.08
115 0.1
116 0.15
117 0.22
118 0.31
119 0.39
120 0.45
121 0.55
122 0.65
123 0.75
124 0.8
125 0.84
126 0.87
127 0.9
128 0.95
129 0.94
130 0.94
131 0.92
132 0.91
133 0.9
134 0.89
135 0.88
136 0.87
137 0.87
138 0.84
139 0.81
140 0.71
141 0.64
142 0.57
143 0.52
144 0.47
145 0.37
146 0.31
147 0.25
148 0.26
149 0.23
150 0.23
151 0.2
152 0.16
153 0.18
154 0.19
155 0.19