Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165PTR3

Protein Details
Accession A0A165PTR3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
346-366QGAGLPKRTRRTRSRDGLPILHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR001499  GPCR_STE3  
Gene Ontology GO:0016020  C:membrane  
GO:0004932  F:mating-type factor pheromone receptor activity  
Pfam View protein in Pfam  
PF02076  STE3  
Amino Acid Sequences MAAALAAVAFLCVVVLVCLLPAYWASRNIAMLALIWWLVLCNVIQGINAVVWAGNVDVRIPVWCDIGTKLLLGVRLAVPATCLCLSNRVRHLLTTGDAKGGIGILSFDLTMCIIVPIIYMALHIIVQGHRFNLTKNFGCSPAVYNTIPALFLVWLPPLILSMFAIMLACITTYCGHRRAIASMPRPPSIFRPSNIPGHLPDVPPPATTIDPMEHRSLTQNEAWQLSSRRRPVSIVAGPWPRPPSSIPTSPVNSGSLSSVSSVHPAGIPSAFSEQVMSIPMPSHVAHWLRPPSDASVNTSPAPSTISNSAYIPDPPPLHDSPTLPHFPPFADASIPAEQGHTLDPGQGAGLPKRTRRTRSRDGLPILTRNMSLSGLRGRENRPEGFDGGAIYMTVVQETA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.04
3 0.04
4 0.04
5 0.04
6 0.04
7 0.05
8 0.06
9 0.1
10 0.12
11 0.15
12 0.18
13 0.2
14 0.21
15 0.21
16 0.21
17 0.17
18 0.15
19 0.12
20 0.1
21 0.08
22 0.07
23 0.06
24 0.06
25 0.06
26 0.06
27 0.05
28 0.05
29 0.06
30 0.06
31 0.07
32 0.07
33 0.08
34 0.07
35 0.07
36 0.06
37 0.05
38 0.05
39 0.05
40 0.05
41 0.05
42 0.05
43 0.06
44 0.06
45 0.07
46 0.08
47 0.1
48 0.11
49 0.11
50 0.12
51 0.13
52 0.13
53 0.16
54 0.15
55 0.13
56 0.13
57 0.13
58 0.14
59 0.12
60 0.13
61 0.11
62 0.12
63 0.12
64 0.1
65 0.1
66 0.1
67 0.13
68 0.11
69 0.12
70 0.11
71 0.2
72 0.23
73 0.29
74 0.34
75 0.36
76 0.36
77 0.36
78 0.37
79 0.3
80 0.3
81 0.27
82 0.23
83 0.19
84 0.18
85 0.17
86 0.15
87 0.13
88 0.11
89 0.05
90 0.05
91 0.04
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.04
105 0.04
106 0.03
107 0.03
108 0.04
109 0.04
110 0.04
111 0.05
112 0.06
113 0.08
114 0.09
115 0.1
116 0.12
117 0.12
118 0.14
119 0.19
120 0.24
121 0.24
122 0.26
123 0.27
124 0.27
125 0.27
126 0.27
127 0.23
128 0.21
129 0.22
130 0.19
131 0.18
132 0.17
133 0.16
134 0.15
135 0.12
136 0.1
137 0.06
138 0.06
139 0.06
140 0.06
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.04
148 0.04
149 0.04
150 0.04
151 0.04
152 0.03
153 0.03
154 0.03
155 0.03
156 0.02
157 0.04
158 0.05
159 0.07
160 0.1
161 0.13
162 0.13
163 0.15
164 0.17
165 0.18
166 0.24
167 0.29
168 0.3
169 0.34
170 0.36
171 0.36
172 0.35
173 0.33
174 0.32
175 0.33
176 0.31
177 0.26
178 0.3
179 0.31
180 0.35
181 0.35
182 0.32
183 0.25
184 0.26
185 0.27
186 0.21
187 0.2
188 0.19
189 0.18
190 0.17
191 0.17
192 0.15
193 0.13
194 0.13
195 0.12
196 0.1
197 0.12
198 0.14
199 0.15
200 0.14
201 0.14
202 0.17
203 0.17
204 0.18
205 0.17
206 0.17
207 0.17
208 0.18
209 0.18
210 0.18
211 0.19
212 0.23
213 0.28
214 0.3
215 0.3
216 0.3
217 0.31
218 0.3
219 0.36
220 0.33
221 0.29
222 0.3
223 0.33
224 0.34
225 0.36
226 0.35
227 0.27
228 0.26
229 0.25
230 0.25
231 0.26
232 0.3
233 0.3
234 0.33
235 0.35
236 0.35
237 0.35
238 0.29
239 0.23
240 0.19
241 0.17
242 0.12
243 0.1
244 0.1
245 0.1
246 0.09
247 0.1
248 0.1
249 0.09
250 0.09
251 0.09
252 0.09
253 0.08
254 0.08
255 0.08
256 0.1
257 0.1
258 0.09
259 0.09
260 0.09
261 0.09
262 0.1
263 0.09
264 0.07
265 0.07
266 0.08
267 0.09
268 0.09
269 0.1
270 0.14
271 0.16
272 0.17
273 0.24
274 0.28
275 0.27
276 0.28
277 0.29
278 0.27
279 0.31
280 0.3
281 0.3
282 0.29
283 0.31
284 0.3
285 0.29
286 0.25
287 0.2
288 0.22
289 0.16
290 0.15
291 0.16
292 0.17
293 0.18
294 0.18
295 0.19
296 0.17
297 0.18
298 0.16
299 0.18
300 0.17
301 0.18
302 0.24
303 0.24
304 0.27
305 0.28
306 0.28
307 0.27
308 0.32
309 0.34
310 0.29
311 0.3
312 0.26
313 0.24
314 0.26
315 0.24
316 0.19
317 0.16
318 0.16
319 0.19
320 0.2
321 0.21
322 0.18
323 0.16
324 0.15
325 0.15
326 0.15
327 0.12
328 0.1
329 0.11
330 0.11
331 0.1
332 0.11
333 0.12
334 0.14
335 0.15
336 0.23
337 0.27
338 0.32
339 0.42
340 0.5
341 0.57
342 0.64
343 0.7
344 0.73
345 0.78
346 0.82
347 0.81
348 0.79
349 0.79
350 0.75
351 0.71
352 0.63
353 0.55
354 0.47
355 0.38
356 0.34
357 0.26
358 0.21
359 0.2
360 0.23
361 0.23
362 0.28
363 0.32
364 0.35
365 0.42
366 0.48
367 0.47
368 0.47
369 0.48
370 0.45
371 0.41
372 0.38
373 0.29
374 0.24
375 0.21
376 0.15
377 0.11
378 0.11
379 0.09