Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2X8T2

Protein Details
Accession G2X8T2    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
242-264KEKGSKMRGGRGRRTTRQVKTICBasic
NLS Segment(s)
PositionSequence
244-255KGSKMRGGRGRR
Subcellular Location(s) cyto 12, mito 11, cyto_nucl 9, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001247  ExoRNase_PH_dom1  
IPR036345  ExoRNase_PH_dom2_sf  
IPR027408  PNPase/RNase_PH_dom_sf  
IPR020568  Ribosomal_S5_D2-typ_fold  
Gene Ontology GO:0000785  C:chromatin  
GO:0000177  C:cytoplasmic exosome (RNase complex)  
GO:0000176  C:nuclear exosome (RNase complex)  
GO:0005730  C:nucleolus  
GO:0004527  F:exonuclease activity  
GO:0000467  P:exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0071031  P:nuclear mRNA surveillance of mRNA 3'-end processing  
GO:0071039  P:nuclear polyadenylation-dependent CUT catabolic process  
GO:0071038  P:nuclear polyadenylation-dependent tRNA catabolic process  
GO:0070478  P:nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decay  
GO:0071051  P:polyadenylation-dependent snoRNA 3'-end processing  
GO:0016075  P:rRNA catabolic process  
GO:0030847  P:termination of RNA polymerase II transcription, exosome-dependent  
GO:0034473  P:U1 snRNA 3'-end processing  
GO:0034475  P:U4 snRNA 3'-end processing  
GO:0034476  P:U5 snRNA 3'-end processing  
KEGG vda:VDAG_06223  -  
Pfam View protein in Pfam  
PF01138  RNase_PH  
CDD cd11370  RNase_PH_RRP41  
Amino Acid Sequences MPLDTSTYGLSLLRVDGRRWNELRRLQAQIRTQDAADGSSYLEIGHTKVMCVVTGPTEPQRRGPAGGQSKDAAVNVSIVVAGFSSVDRRKYGRNDKRISELEATVSKAFASTLHTHLFPHSSIYISLHVLSQDGSLLAALLNATTLALVDAGIPMTDYIAACTAGSTSTYAAADDGADPLLDLNTQEEQELPFLTAATLGDSDKVVVLVCESRVQASRLEGLLAVAVDGCKQIRGKLDAVVKEKGSKMRGGRGRRTTRQVKTICMGWARWYDTPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.2
3 0.27
4 0.31
5 0.39
6 0.42
7 0.46
8 0.49
9 0.53
10 0.6
11 0.58
12 0.61
13 0.58
14 0.62
15 0.62
16 0.59
17 0.58
18 0.51
19 0.45
20 0.4
21 0.35
22 0.29
23 0.22
24 0.16
25 0.12
26 0.1
27 0.1
28 0.07
29 0.08
30 0.07
31 0.07
32 0.11
33 0.1
34 0.1
35 0.13
36 0.14
37 0.13
38 0.13
39 0.13
40 0.12
41 0.13
42 0.16
43 0.21
44 0.27
45 0.28
46 0.31
47 0.36
48 0.35
49 0.36
50 0.36
51 0.39
52 0.41
53 0.42
54 0.4
55 0.36
56 0.35
57 0.33
58 0.3
59 0.21
60 0.12
61 0.11
62 0.08
63 0.08
64 0.06
65 0.05
66 0.05
67 0.04
68 0.04
69 0.03
70 0.04
71 0.09
72 0.11
73 0.13
74 0.15
75 0.17
76 0.23
77 0.32
78 0.44
79 0.49
80 0.57
81 0.61
82 0.61
83 0.67
84 0.64
85 0.58
86 0.5
87 0.4
88 0.33
89 0.29
90 0.28
91 0.21
92 0.18
93 0.14
94 0.11
95 0.1
96 0.08
97 0.11
98 0.11
99 0.14
100 0.15
101 0.16
102 0.16
103 0.17
104 0.18
105 0.13
106 0.13
107 0.1
108 0.1
109 0.1
110 0.11
111 0.12
112 0.1
113 0.11
114 0.09
115 0.08
116 0.08
117 0.08
118 0.06
119 0.05
120 0.04
121 0.04
122 0.03
123 0.03
124 0.03
125 0.03
126 0.03
127 0.02
128 0.02
129 0.02
130 0.02
131 0.02
132 0.02
133 0.02
134 0.02
135 0.02
136 0.02
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.03
143 0.03
144 0.03
145 0.04
146 0.04
147 0.05
148 0.05
149 0.05
150 0.05
151 0.04
152 0.05
153 0.05
154 0.05
155 0.06
156 0.06
157 0.06
158 0.06
159 0.06
160 0.06
161 0.05
162 0.05
163 0.04
164 0.04
165 0.04
166 0.04
167 0.04
168 0.04
169 0.04
170 0.05
171 0.06
172 0.06
173 0.07
174 0.07
175 0.08
176 0.08
177 0.09
178 0.08
179 0.07
180 0.07
181 0.07
182 0.07
183 0.06
184 0.06
185 0.07
186 0.06
187 0.07
188 0.07
189 0.07
190 0.06
191 0.07
192 0.05
193 0.05
194 0.06
195 0.07
196 0.07
197 0.1
198 0.1
199 0.12
200 0.14
201 0.15
202 0.16
203 0.16
204 0.18
205 0.16
206 0.17
207 0.14
208 0.13
209 0.12
210 0.1
211 0.08
212 0.05
213 0.05
214 0.05
215 0.06
216 0.06
217 0.09
218 0.1
219 0.12
220 0.18
221 0.22
222 0.23
223 0.28
224 0.35
225 0.39
226 0.43
227 0.44
228 0.4
229 0.4
230 0.43
231 0.42
232 0.38
233 0.38
234 0.38
235 0.43
236 0.51
237 0.55
238 0.62
239 0.67
240 0.74
241 0.76
242 0.82
243 0.82
244 0.81
245 0.82
246 0.75
247 0.7
248 0.65
249 0.6
250 0.56
251 0.5
252 0.44
253 0.4
254 0.43
255 0.42