Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165PFC3

Protein Details
Accession A0A165PFC3    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
96-119LDKDRRAILDRKDRKKNGKSGEDVBasic
NLS Segment(s)
PositionSequence
11-50RRKSRKAHFAAPSSVRRKIMSSALSKELRGKHNTRSLPIR
59-63RGKYK
106-111RKDRKK
Subcellular Location(s) nucl 13, mito 11, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MKFNADVSSSRRKSRKAHFAAPSSVRRKIMSSALSKELRGKHNTRSLPIRKDDEVRIVRGKYKGREGKVTQRDKSNGATVPIGIHPSNVVITTIKLDKDRRAILDRKDRKKNGKSGEDVEMVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.68
4 0.73
5 0.73
6 0.73
7 0.74
8 0.73
9 0.72
10 0.65
11 0.62
12 0.54
13 0.47
14 0.44
15 0.39
16 0.39
17 0.36
18 0.36
19 0.35
20 0.4
21 0.4
22 0.38
23 0.41
24 0.4
25 0.39
26 0.41
27 0.4
28 0.4
29 0.47
30 0.49
31 0.47
32 0.51
33 0.53
34 0.52
35 0.54
36 0.51
37 0.44
38 0.46
39 0.44
40 0.43
41 0.38
42 0.35
43 0.34
44 0.3
45 0.32
46 0.33
47 0.36
48 0.29
49 0.36
50 0.39
51 0.37
52 0.44
53 0.44
54 0.5
55 0.55
56 0.6
57 0.54
58 0.54
59 0.54
60 0.49
61 0.47
62 0.41
63 0.33
64 0.27
65 0.25
66 0.19
67 0.18
68 0.17
69 0.17
70 0.13
71 0.11
72 0.09
73 0.1
74 0.1
75 0.09
76 0.09
77 0.07
78 0.07
79 0.1
80 0.12
81 0.13
82 0.18
83 0.2
84 0.24
85 0.3
86 0.33
87 0.36
88 0.41
89 0.46
90 0.5
91 0.59
92 0.64
93 0.68
94 0.75
95 0.79
96 0.82
97 0.85
98 0.85
99 0.84
100 0.83
101 0.8
102 0.74
103 0.72