Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165QR61

Protein Details
Accession A0A165QR61    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
79-100PVTAKKTKKAARPLKRKRAAPEBasic
130-152RTSPAHTPKKPPPRKIVNRAEVVHydrophilic
NLS Segment(s)
PositionSequence
82-98AKKTKKAARPLKRKRAA
Subcellular Location(s) cyto 22.5, cyto_nucl 13, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR033315  Fan1-like  
IPR011856  tRNA_endonuc-like_dom_sf  
IPR014883  VRR_NUC  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003676  F:nucleic acid binding  
GO:0004528  F:phosphodiesterase I activity  
GO:0036297  P:interstrand cross-link repair  
Pfam View protein in Pfam  
PF08774  VRR_NUC  
Amino Acid Sequences LGGVALAVICRLMCEDYSGRTGGVPDLIIWNGEAQECKFVEVKGPGDRLQENQKVWIDVLLQAGVVVEECRVVDRGAGPVTAKKTKKAARPLKRKRAAPESEGESRAIESEDESEDIDYSQLDTSAIDNRTSPAHTPKKPPPRKIVNRAEVVIIPSPVRLTMQGKRPERVRSTSPEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.14
3 0.17
4 0.19
5 0.2
6 0.19
7 0.18
8 0.18
9 0.14
10 0.14
11 0.11
12 0.09
13 0.11
14 0.11
15 0.1
16 0.1
17 0.1
18 0.09
19 0.1
20 0.1
21 0.09
22 0.13
23 0.13
24 0.15
25 0.16
26 0.15
27 0.19
28 0.21
29 0.24
30 0.24
31 0.27
32 0.27
33 0.29
34 0.3
35 0.29
36 0.34
37 0.36
38 0.32
39 0.34
40 0.34
41 0.31
42 0.3
43 0.27
44 0.19
45 0.15
46 0.15
47 0.1
48 0.09
49 0.08
50 0.07
51 0.06
52 0.05
53 0.04
54 0.03
55 0.03
56 0.03
57 0.04
58 0.05
59 0.05
60 0.06
61 0.06
62 0.08
63 0.09
64 0.09
65 0.09
66 0.11
67 0.15
68 0.21
69 0.21
70 0.22
71 0.29
72 0.34
73 0.41
74 0.49
75 0.55
76 0.59
77 0.7
78 0.78
79 0.82
80 0.83
81 0.81
82 0.76
83 0.76
84 0.69
85 0.6
86 0.54
87 0.48
88 0.45
89 0.42
90 0.36
91 0.26
92 0.22
93 0.2
94 0.16
95 0.1
96 0.07
97 0.07
98 0.07
99 0.08
100 0.08
101 0.08
102 0.07
103 0.07
104 0.07
105 0.06
106 0.06
107 0.05
108 0.05
109 0.05
110 0.05
111 0.06
112 0.12
113 0.13
114 0.13
115 0.13
116 0.14
117 0.16
118 0.17
119 0.19
120 0.23
121 0.31
122 0.36
123 0.43
124 0.53
125 0.62
126 0.7
127 0.76
128 0.76
129 0.78
130 0.84
131 0.86
132 0.87
133 0.84
134 0.79
135 0.72
136 0.65
137 0.55
138 0.47
139 0.38
140 0.29
141 0.21
142 0.16
143 0.16
144 0.14
145 0.13
146 0.14
147 0.18
148 0.23
149 0.32
150 0.42
151 0.46
152 0.52
153 0.57
154 0.62
155 0.63
156 0.63
157 0.6