Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WWQ8

Protein Details
Accession G2WWQ8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
90-109PSDQPGKPGKPEKPHKPGKPBasic
NLS Segment(s)
PositionSequence
95-109GKPGKPEKPHKPGKP
Subcellular Location(s) extr 22, cyto 3
Family & Domain DBs
KEGG vda:VDAG_02044  -  
Amino Acid Sequences MGNYRSALLLSILAASTVQASFWTPPKGHSPPDCETTTTFATLTVTSSEIAGPTAGPTGGPIPPIPEHSSAIEEPVYPQPSVVDPTSPCPSDQPGKPGKPEKPHKPGKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.05
6 0.05
7 0.07
8 0.09
9 0.14
10 0.18
11 0.17
12 0.19
13 0.27
14 0.31
15 0.35
16 0.38
17 0.41
18 0.4
19 0.45
20 0.44
21 0.38
22 0.35
23 0.33
24 0.29
25 0.23
26 0.19
27 0.14
28 0.14
29 0.12
30 0.12
31 0.08
32 0.08
33 0.07
34 0.07
35 0.07
36 0.06
37 0.06
38 0.05
39 0.04
40 0.04
41 0.04
42 0.04
43 0.03
44 0.04
45 0.05
46 0.05
47 0.06
48 0.06
49 0.08
50 0.09
51 0.12
52 0.15
53 0.15
54 0.17
55 0.17
56 0.2
57 0.18
58 0.19
59 0.16
60 0.13
61 0.14
62 0.18
63 0.19
64 0.15
65 0.16
66 0.15
67 0.16
68 0.19
69 0.17
70 0.16
71 0.15
72 0.2
73 0.25
74 0.25
75 0.24
76 0.23
77 0.27
78 0.31
79 0.33
80 0.37
81 0.42
82 0.45
83 0.53
84 0.6
85 0.63
86 0.66
87 0.73
88 0.75
89 0.77