Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2XGI1

Protein Details
Accession G2XGI1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-81STTIVFRPKAQRRPQWQWNTGAHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 12.5, nucl 10, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000644  CBS_dom  
IPR046342  CBS_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005641  C:nuclear envelope lumen  
GO:0031588  C:nucleotide-activated protein kinase complex  
GO:0005886  C:plasma membrane  
GO:0043531  F:ADP binding  
GO:0016208  F:AMP binding  
GO:0004679  F:AMP-activated protein kinase activity  
GO:0005524  F:ATP binding  
GO:0042802  F:identical protein binding  
GO:0043539  F:protein serine/threonine kinase activator activity  
GO:0006914  P:autophagy  
GO:0030447  P:filamentous growth  
GO:0007031  P:peroxisome organization  
GO:0045722  P:positive regulation of gluconeogenesis  
GO:2000217  P:regulation of invasive growth in response to glucose limitation  
GO:0006357  P:regulation of transcription by RNA polymerase II  
KEGG vda:VDAG_09263  -  
Pfam View protein in Pfam  
PF00571  CBS  
PROSITE View protein in PROSITE  
PS51371  CBS  
CDD cd04641  CBS_euAMPK_gamma-like_repeat2  
Amino Acid Sequences MPDHDMDLENNPAAAAPADSGAEAGTVPGPRVTVAAEVAAAAFPPPPPPPPPPHIRSSDSTTIVFRPKAQRRPQWQWNTGASRLRYRGLDCQTERFLLLCFPRAIREFLKVRTSYDVLPLSFRLIVLDNDLLIKKSLNILIQNYIEKAIGVSPLETVSVNPMRPLYEACRRMLKTKARRIPLVDLDDETRRETVVSVITQYRILKFIAVNNEHNTVMLKKAVRDVGLGTWGHIATAHMSTSVLDVVSLMVKHDISCVPLVDKHNRLLNVFEAVDIIPCIKGGAYDDLSSSVGEALCKRPDDFPGIYTCGPEDRLDSIFDTVRKSRVHRLIVVDDENRLVGIISLSDILKYVLLHGEEDDLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.09
3 0.06
4 0.07
5 0.08
6 0.08
7 0.08
8 0.07
9 0.07
10 0.06
11 0.06
12 0.08
13 0.08
14 0.09
15 0.09
16 0.1
17 0.1
18 0.11
19 0.11
20 0.1
21 0.1
22 0.1
23 0.09
24 0.09
25 0.09
26 0.08
27 0.07
28 0.06
29 0.06
30 0.06
31 0.09
32 0.11
33 0.14
34 0.19
35 0.25
36 0.32
37 0.38
38 0.47
39 0.49
40 0.53
41 0.56
42 0.56
43 0.55
44 0.56
45 0.56
46 0.5
47 0.46
48 0.42
49 0.4
50 0.4
51 0.36
52 0.34
53 0.38
54 0.44
55 0.53
56 0.6
57 0.66
58 0.71
59 0.8
60 0.84
61 0.84
62 0.8
63 0.77
64 0.75
65 0.71
66 0.66
67 0.63
68 0.55
69 0.51
70 0.49
71 0.45
72 0.39
73 0.37
74 0.4
75 0.39
76 0.45
77 0.4
78 0.43
79 0.42
80 0.41
81 0.38
82 0.3
83 0.25
84 0.2
85 0.2
86 0.18
87 0.17
88 0.17
89 0.2
90 0.22
91 0.25
92 0.22
93 0.28
94 0.28
95 0.3
96 0.37
97 0.34
98 0.34
99 0.35
100 0.35
101 0.29
102 0.3
103 0.29
104 0.22
105 0.23
106 0.22
107 0.19
108 0.17
109 0.16
110 0.11
111 0.1
112 0.1
113 0.11
114 0.11
115 0.09
116 0.1
117 0.11
118 0.1
119 0.09
120 0.09
121 0.07
122 0.09
123 0.11
124 0.11
125 0.13
126 0.14
127 0.17
128 0.18
129 0.19
130 0.17
131 0.16
132 0.14
133 0.11
134 0.1
135 0.07
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.07
142 0.06
143 0.06
144 0.09
145 0.12
146 0.11
147 0.12
148 0.12
149 0.12
150 0.12
151 0.14
152 0.15
153 0.21
154 0.24
155 0.24
156 0.31
157 0.31
158 0.34
159 0.4
160 0.45
161 0.46
162 0.53
163 0.59
164 0.55
165 0.57
166 0.57
167 0.54
168 0.5
169 0.44
170 0.34
171 0.28
172 0.27
173 0.26
174 0.24
175 0.19
176 0.14
177 0.11
178 0.1
179 0.09
180 0.09
181 0.09
182 0.08
183 0.09
184 0.1
185 0.11
186 0.13
187 0.13
188 0.13
189 0.12
190 0.12
191 0.11
192 0.11
193 0.14
194 0.2
195 0.22
196 0.24
197 0.25
198 0.27
199 0.26
200 0.25
201 0.22
202 0.16
203 0.14
204 0.14
205 0.13
206 0.12
207 0.15
208 0.17
209 0.16
210 0.16
211 0.16
212 0.13
213 0.17
214 0.16
215 0.13
216 0.13
217 0.12
218 0.11
219 0.1
220 0.1
221 0.07
222 0.08
223 0.08
224 0.06
225 0.07
226 0.07
227 0.07
228 0.07
229 0.05
230 0.04
231 0.04
232 0.05
233 0.06
234 0.06
235 0.06
236 0.06
237 0.06
238 0.07
239 0.09
240 0.09
241 0.09
242 0.1
243 0.1
244 0.11
245 0.16
246 0.2
247 0.25
248 0.28
249 0.3
250 0.34
251 0.34
252 0.33
253 0.31
254 0.28
255 0.25
256 0.22
257 0.18
258 0.14
259 0.13
260 0.13
261 0.11
262 0.1
263 0.06
264 0.06
265 0.06
266 0.05
267 0.05
268 0.07
269 0.12
270 0.13
271 0.13
272 0.14
273 0.15
274 0.16
275 0.15
276 0.13
277 0.1
278 0.09
279 0.1
280 0.11
281 0.14
282 0.17
283 0.19
284 0.2
285 0.21
286 0.24
287 0.29
288 0.28
289 0.26
290 0.28
291 0.31
292 0.29
293 0.28
294 0.26
295 0.22
296 0.22
297 0.2
298 0.18
299 0.16
300 0.17
301 0.18
302 0.18
303 0.19
304 0.21
305 0.22
306 0.25
307 0.25
308 0.29
309 0.31
310 0.35
311 0.42
312 0.47
313 0.51
314 0.51
315 0.55
316 0.55
317 0.57
318 0.58
319 0.49
320 0.42
321 0.37
322 0.32
323 0.25
324 0.19
325 0.13
326 0.08
327 0.07
328 0.06
329 0.06
330 0.08
331 0.08
332 0.08
333 0.09
334 0.09
335 0.09
336 0.09
337 0.1
338 0.13
339 0.13
340 0.14
341 0.14