Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165LY44

Protein Details
Accession A0A165LY44    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
78-97RSPPRRIRVKLERKRNDEENBasic
NLS Segment(s)
PositionSequence
78-92RSPPRRIRVKLERKR
Subcellular Location(s) nucl 12, mito 12, mito_nucl 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR000054  Ribosomal_L31e  
IPR020052  Ribosomal_L31e_CS  
IPR023621  Ribosomal_L31e_dom_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01198  Ribosomal_L31e  
PROSITE View protein in PROSITE  
PS01144  RIBOSOMAL_L31E  
CDD cd00463  Ribosomal_L31e  
Amino Acid Sequences MAPSKTSKKTGKTRSALQDVVTREYTIHLHKLVHGRSFKKRAPHAVKSVVEFAQKAMGTTDVRVDPRLNQQLWERGIRSPPRRIRVKLERKRNDEENAKEKLYTYASYVPVESFKGLETVVVDAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.77
3 0.69
4 0.61
5 0.57
6 0.49
7 0.47
8 0.39
9 0.3
10 0.23
11 0.23
12 0.24
13 0.21
14 0.21
15 0.18
16 0.18
17 0.22
18 0.29
19 0.3
20 0.34
21 0.37
22 0.39
23 0.46
24 0.53
25 0.52
26 0.53
27 0.56
28 0.6
29 0.63
30 0.64
31 0.62
32 0.62
33 0.6
34 0.54
35 0.52
36 0.42
37 0.35
38 0.28
39 0.21
40 0.17
41 0.16
42 0.14
43 0.11
44 0.12
45 0.11
46 0.11
47 0.13
48 0.1
49 0.11
50 0.12
51 0.12
52 0.12
53 0.19
54 0.25
55 0.23
56 0.23
57 0.25
58 0.3
59 0.32
60 0.32
61 0.26
62 0.22
63 0.29
64 0.35
65 0.38
66 0.42
67 0.47
68 0.53
69 0.59
70 0.6
71 0.63
72 0.67
73 0.73
74 0.72
75 0.76
76 0.78
77 0.77
78 0.81
79 0.77
80 0.73
81 0.71
82 0.69
83 0.64
84 0.6
85 0.54
86 0.47
87 0.42
88 0.38
89 0.32
90 0.25
91 0.23
92 0.23
93 0.25
94 0.26
95 0.25
96 0.23
97 0.22
98 0.22
99 0.19
100 0.14
101 0.12
102 0.12
103 0.11
104 0.11
105 0.1