Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165R0D4

Protein Details
Accession A0A165R0D4    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-63MALVQWKRDKWRRERERKLMDGEQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 8, nucl 7, cyto_nucl 7, cyto 5, extr 2, pero 2, cysk 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR024242  NCE101  
Gene Ontology GO:0009306  P:protein secretion  
Pfam View protein in Pfam  
PF11654  NCE101  
Amino Acid Sequences MAPLLSRTLDPLLGVFTGVFAYYLYENSPRTALPEDQRLMALVQWKRDKWRRERERKLMDGEQDVDLSAIRAAVEKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.08
3 0.06
4 0.06
5 0.06
6 0.06
7 0.04
8 0.06
9 0.06
10 0.06
11 0.07
12 0.1
13 0.11
14 0.11
15 0.12
16 0.11
17 0.13
18 0.16
19 0.18
20 0.18
21 0.23
22 0.23
23 0.23
24 0.23
25 0.2
26 0.18
27 0.15
28 0.19
29 0.14
30 0.2
31 0.23
32 0.24
33 0.32
34 0.4
35 0.47
36 0.51
37 0.61
38 0.66
39 0.74
40 0.83
41 0.86
42 0.88
43 0.84
44 0.81
45 0.75
46 0.68
47 0.61
48 0.52
49 0.43
50 0.34
51 0.28
52 0.21
53 0.16
54 0.13
55 0.08
56 0.06
57 0.05