Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165PNG5

Protein Details
Accession A0A165PNG5    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-25SSTARYKNVREEPKHQNPLVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 7, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004879  DUF255  
IPR024705  Ssp411  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF03190  Thioredox_DsbH  
Amino Acid Sequences MSSSVSSTARYKNVREEPKHQNPLVNAKSPYLLQHAEDPVDWFEWARRHSRRREGRTSLYSCPSGIQHVTVSRLSFSASRSAHRGHAGCHVLPHESFEDEVTAKLMNENYINIKVDREERPDVDRLYMSFLQATTREAGRRPSVRLTPEPHPFFSGTYCLPGNFRQVPMKLVEVRTLLSVKLPTPGRAPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.65
4 0.69
5 0.75
6 0.81
7 0.72
8 0.67
9 0.61
10 0.65
11 0.62
12 0.58
13 0.48
14 0.41
15 0.41
16 0.36
17 0.34
18 0.29
19 0.25
20 0.2
21 0.23
22 0.24
23 0.23
24 0.23
25 0.23
26 0.19
27 0.18
28 0.17
29 0.12
30 0.14
31 0.17
32 0.19
33 0.26
34 0.33
35 0.4
36 0.49
37 0.59
38 0.66
39 0.71
40 0.78
41 0.77
42 0.77
43 0.77
44 0.73
45 0.67
46 0.6
47 0.52
48 0.43
49 0.36
50 0.29
51 0.23
52 0.18
53 0.15
54 0.13
55 0.13
56 0.16
57 0.15
58 0.15
59 0.13
60 0.12
61 0.12
62 0.12
63 0.12
64 0.16
65 0.16
66 0.17
67 0.2
68 0.21
69 0.22
70 0.25
71 0.24
72 0.18
73 0.24
74 0.25
75 0.22
76 0.22
77 0.2
78 0.18
79 0.17
80 0.17
81 0.11
82 0.09
83 0.09
84 0.08
85 0.09
86 0.08
87 0.08
88 0.07
89 0.06
90 0.06
91 0.07
92 0.07
93 0.07
94 0.07
95 0.08
96 0.09
97 0.11
98 0.12
99 0.11
100 0.12
101 0.12
102 0.16
103 0.19
104 0.22
105 0.23
106 0.24
107 0.27
108 0.3
109 0.29
110 0.27
111 0.24
112 0.19
113 0.23
114 0.21
115 0.18
116 0.15
117 0.14
118 0.14
119 0.14
120 0.15
121 0.11
122 0.13
123 0.14
124 0.15
125 0.2
126 0.25
127 0.28
128 0.3
129 0.34
130 0.37
131 0.41
132 0.46
133 0.47
134 0.47
135 0.53
136 0.54
137 0.49
138 0.47
139 0.42
140 0.37
141 0.33
142 0.3
143 0.21
144 0.21
145 0.2
146 0.18
147 0.2
148 0.21
149 0.26
150 0.25
151 0.28
152 0.31
153 0.31
154 0.33
155 0.33
156 0.37
157 0.34
158 0.33
159 0.33
160 0.28
161 0.28
162 0.28
163 0.26
164 0.21
165 0.2
166 0.2
167 0.17
168 0.23
169 0.24
170 0.24