Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165LHD9

Protein Details
Accession A0A165LHD9   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
253-283GSSMEEKKGRKRTREVSRKKGSRNKKRQRLPBasic
NLS Segment(s)
PositionSequence
258-283EKKGRKRTREVSRKKGSRNKKRQRLP
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046520  DUF6697  
Pfam View protein in Pfam  
PF20411  DUF6697  
Amino Acid Sequences MSDSEESASEGGSENDDIDPDNQSHDRDYETDDDDPEMLALADMTIRDFEVHEFLQVKPDNVVPDMDSLFDGSFVSVSGKKVWQTTLQESINCARHSPRTRKCSTDTTIWMPYEDLSRCILVYPAQGYNFMKSRPIPVQRKHSKEWPQVGDMQELCYSANASWYYCGTYKCVGMSVLRLDELCKLEETKFARIFDTLVQRTPTQGSKSTIKTRGSLANAIRDMYRDGTLHTRCYGLQLVGYDNEIKAAFIKAGSSMEEKKGRKRTREVSRKKGSRNKKRQRLP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.1
4 0.11
5 0.11
6 0.13
7 0.12
8 0.17
9 0.17
10 0.19
11 0.21
12 0.2
13 0.22
14 0.21
15 0.24
16 0.24
17 0.25
18 0.26
19 0.24
20 0.24
21 0.22
22 0.2
23 0.16
24 0.12
25 0.08
26 0.06
27 0.05
28 0.04
29 0.04
30 0.04
31 0.05
32 0.05
33 0.05
34 0.06
35 0.07
36 0.08
37 0.11
38 0.11
39 0.14
40 0.15
41 0.15
42 0.23
43 0.23
44 0.23
45 0.2
46 0.22
47 0.21
48 0.2
49 0.21
50 0.14
51 0.15
52 0.14
53 0.14
54 0.12
55 0.11
56 0.1
57 0.09
58 0.08
59 0.06
60 0.06
61 0.05
62 0.08
63 0.08
64 0.1
65 0.12
66 0.14
67 0.15
68 0.17
69 0.19
70 0.22
71 0.26
72 0.29
73 0.34
74 0.34
75 0.33
76 0.34
77 0.37
78 0.36
79 0.31
80 0.28
81 0.23
82 0.3
83 0.38
84 0.46
85 0.5
86 0.53
87 0.57
88 0.61
89 0.63
90 0.62
91 0.57
92 0.54
93 0.49
94 0.45
95 0.46
96 0.41
97 0.37
98 0.29
99 0.26
100 0.23
101 0.19
102 0.16
103 0.12
104 0.12
105 0.12
106 0.12
107 0.12
108 0.08
109 0.09
110 0.09
111 0.1
112 0.1
113 0.13
114 0.13
115 0.15
116 0.16
117 0.15
118 0.15
119 0.14
120 0.17
121 0.21
122 0.3
123 0.36
124 0.4
125 0.51
126 0.57
127 0.62
128 0.61
129 0.64
130 0.64
131 0.64
132 0.65
133 0.57
134 0.51
135 0.49
136 0.47
137 0.41
138 0.32
139 0.26
140 0.19
141 0.16
142 0.14
143 0.1
144 0.1
145 0.06
146 0.09
147 0.08
148 0.08
149 0.09
150 0.09
151 0.11
152 0.12
153 0.13
154 0.12
155 0.13
156 0.14
157 0.13
158 0.14
159 0.12
160 0.11
161 0.12
162 0.12
163 0.11
164 0.11
165 0.1
166 0.1
167 0.13
168 0.14
169 0.13
170 0.11
171 0.13
172 0.13
173 0.18
174 0.21
175 0.24
176 0.26
177 0.26
178 0.26
179 0.25
180 0.26
181 0.25
182 0.31
183 0.25
184 0.25
185 0.26
186 0.25
187 0.27
188 0.28
189 0.28
190 0.22
191 0.25
192 0.27
193 0.31
194 0.37
195 0.44
196 0.48
197 0.46
198 0.44
199 0.44
200 0.46
201 0.43
202 0.43
203 0.37
204 0.37
205 0.36
206 0.35
207 0.32
208 0.27
209 0.25
210 0.21
211 0.21
212 0.14
213 0.15
214 0.23
215 0.25
216 0.26
217 0.25
218 0.25
219 0.22
220 0.26
221 0.26
222 0.18
223 0.18
224 0.16
225 0.18
226 0.17
227 0.19
228 0.16
229 0.14
230 0.15
231 0.13
232 0.12
233 0.11
234 0.11
235 0.1
236 0.09
237 0.1
238 0.09
239 0.1
240 0.13
241 0.16
242 0.18
243 0.25
244 0.34
245 0.37
246 0.45
247 0.55
248 0.61
249 0.65
250 0.72
251 0.75
252 0.78
253 0.86
254 0.87
255 0.87
256 0.9
257 0.9
258 0.91
259 0.91
260 0.91
261 0.91
262 0.92
263 0.92