Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165L9U7

Protein Details
Accession A0A165L9U7    Localization Confidence Low Confidence Score 5.6
NoLS Segment(s)
PositionSequenceProtein Nature
51-70RDPEQTKKLFKKYKPTHVIHBasic
NLS Segment(s)
Subcellular Location(s) cyto 13, cyto_nucl 8.5, extr 4, mito 3, nucl 2, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001509  Epimerase_deHydtase  
IPR028614  GDP_fucose/colitose_synth  
IPR036291  NAD(P)-bd_dom_sf  
Gene Ontology GO:0050577  F:GDP-L-fucose synthase activity  
GO:0042351  P:'de novo' GDP-L-fucose biosynthetic process  
Pfam View protein in Pfam  
PF01370  Epimerase  
CDD cd05239  GDP_FS_SDR_e  
Amino Acid Sequences MSQSVILVTGGTGLVGSAIRHIIETEPAGSRFGKKPGEEWVFVSSSEGDLRDPEQTKKLFKKYKPTHVIHLAALVGGLFKNMKYKLTFLRDNILINDNVLHTSHTTGVEKVISCLSTCVFPDKVAYPLDETKIHLGLPHESNFGYAHAKRMVDVQNHAYKDQFGDNYTSAIPTNVFGPYDNFDLEGSHVIPGLIHKCYLAKKNGTPFVVMGTGKPLRQFIYSYDLAKLFIWQLREYDDVEPVILSVGEDEEVSIKQVADAIVKAVDFQGEYTFDTTKADGQFRKPASNKKLLSLMGDFEFTPFDKALDETVKWFVANYDNARTGLNGRPTGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.06
5 0.08
6 0.08
7 0.08
8 0.09
9 0.1
10 0.12
11 0.13
12 0.14
13 0.17
14 0.18
15 0.2
16 0.2
17 0.24
18 0.26
19 0.31
20 0.34
21 0.32
22 0.33
23 0.41
24 0.46
25 0.42
26 0.41
27 0.38
28 0.33
29 0.32
30 0.32
31 0.22
32 0.18
33 0.17
34 0.16
35 0.11
36 0.12
37 0.13
38 0.18
39 0.21
40 0.23
41 0.28
42 0.31
43 0.4
44 0.47
45 0.56
46 0.58
47 0.61
48 0.69
49 0.72
50 0.8
51 0.81
52 0.76
53 0.75
54 0.73
55 0.7
56 0.59
57 0.51
58 0.4
59 0.3
60 0.25
61 0.17
62 0.09
63 0.06
64 0.06
65 0.05
66 0.05
67 0.11
68 0.12
69 0.15
70 0.16
71 0.2
72 0.27
73 0.34
74 0.38
75 0.35
76 0.4
77 0.39
78 0.39
79 0.37
80 0.32
81 0.25
82 0.2
83 0.2
84 0.14
85 0.13
86 0.12
87 0.1
88 0.08
89 0.09
90 0.11
91 0.12
92 0.13
93 0.12
94 0.13
95 0.14
96 0.14
97 0.14
98 0.13
99 0.11
100 0.1
101 0.11
102 0.1
103 0.09
104 0.1
105 0.12
106 0.11
107 0.11
108 0.13
109 0.14
110 0.16
111 0.15
112 0.15
113 0.15
114 0.17
115 0.19
116 0.18
117 0.18
118 0.17
119 0.16
120 0.16
121 0.14
122 0.13
123 0.15
124 0.16
125 0.16
126 0.16
127 0.15
128 0.16
129 0.15
130 0.15
131 0.15
132 0.13
133 0.15
134 0.16
135 0.16
136 0.15
137 0.2
138 0.24
139 0.21
140 0.23
141 0.25
142 0.28
143 0.29
144 0.29
145 0.24
146 0.2
147 0.19
148 0.19
149 0.15
150 0.1
151 0.12
152 0.12
153 0.13
154 0.13
155 0.12
156 0.1
157 0.09
158 0.09
159 0.06
160 0.07
161 0.06
162 0.06
163 0.06
164 0.07
165 0.09
166 0.1
167 0.1
168 0.09
169 0.09
170 0.09
171 0.1
172 0.09
173 0.08
174 0.07
175 0.07
176 0.06
177 0.06
178 0.07
179 0.09
180 0.08
181 0.08
182 0.08
183 0.1
184 0.14
185 0.2
186 0.23
187 0.26
188 0.29
189 0.36
190 0.41
191 0.4
192 0.37
193 0.32
194 0.28
195 0.27
196 0.23
197 0.16
198 0.16
199 0.17
200 0.17
201 0.18
202 0.17
203 0.16
204 0.17
205 0.18
206 0.14
207 0.19
208 0.21
209 0.21
210 0.22
211 0.21
212 0.2
213 0.19
214 0.18
215 0.14
216 0.14
217 0.15
218 0.13
219 0.14
220 0.16
221 0.17
222 0.19
223 0.17
224 0.17
225 0.15
226 0.14
227 0.13
228 0.1
229 0.09
230 0.07
231 0.05
232 0.04
233 0.04
234 0.04
235 0.04
236 0.04
237 0.05
238 0.06
239 0.07
240 0.07
241 0.07
242 0.07
243 0.09
244 0.09
245 0.09
246 0.09
247 0.09
248 0.09
249 0.09
250 0.09
251 0.08
252 0.08
253 0.07
254 0.07
255 0.08
256 0.09
257 0.1
258 0.12
259 0.12
260 0.12
261 0.14
262 0.14
263 0.17
264 0.19
265 0.24
266 0.26
267 0.3
268 0.38
269 0.39
270 0.48
271 0.49
272 0.56
273 0.58
274 0.64
275 0.61
276 0.57
277 0.6
278 0.52
279 0.5
280 0.42
281 0.37
282 0.28
283 0.28
284 0.24
285 0.18
286 0.19
287 0.15
288 0.16
289 0.13
290 0.12
291 0.12
292 0.13
293 0.16
294 0.19
295 0.19
296 0.19
297 0.22
298 0.22
299 0.21
300 0.21
301 0.18
302 0.2
303 0.25
304 0.27
305 0.3
306 0.32
307 0.33
308 0.33
309 0.33
310 0.31
311 0.32
312 0.35