Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165MTJ6

Protein Details
Accession A0A165MTJ6    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGRPCAVRRRSRARQSITPSKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 12, mito 10.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004045  Glutathione_S-Trfase_N  
IPR036249  Thioredoxin-like_sf  
Pfam View protein in Pfam  
PF13409  GST_N_2  
Amino Acid Sequences MGRPCAVRRRSRARQSITPSKAWSPNTWKTRYLLNLKGLPYHMQWVEYPDIASLHKSFGLPPTYTRTIIAYTLLMIYDPRTKRVIADSIKIAAYLDDEYIETPAVFPKELRAFRAIFNQAFMGAIGRLTLSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.84
4 0.78
5 0.72
6 0.66
7 0.62
8 0.6
9 0.54
10 0.52
11 0.49
12 0.54
13 0.57
14 0.57
15 0.53
16 0.48
17 0.52
18 0.52
19 0.5
20 0.47
21 0.45
22 0.46
23 0.44
24 0.45
25 0.4
26 0.35
27 0.29
28 0.27
29 0.21
30 0.18
31 0.17
32 0.19
33 0.19
34 0.17
35 0.16
36 0.12
37 0.12
38 0.11
39 0.13
40 0.09
41 0.08
42 0.09
43 0.09
44 0.09
45 0.12
46 0.15
47 0.14
48 0.15
49 0.21
50 0.22
51 0.23
52 0.23
53 0.2
54 0.17
55 0.17
56 0.16
57 0.1
58 0.08
59 0.07
60 0.07
61 0.06
62 0.05
63 0.06
64 0.13
65 0.13
66 0.15
67 0.17
68 0.17
69 0.18
70 0.22
71 0.28
72 0.23
73 0.26
74 0.25
75 0.26
76 0.26
77 0.25
78 0.21
79 0.13
80 0.12
81 0.09
82 0.08
83 0.06
84 0.06
85 0.07
86 0.07
87 0.08
88 0.06
89 0.06
90 0.09
91 0.1
92 0.1
93 0.1
94 0.16
95 0.24
96 0.26
97 0.29
98 0.3
99 0.3
100 0.32
101 0.41
102 0.4
103 0.31
104 0.32
105 0.29
106 0.25
107 0.24
108 0.22
109 0.15
110 0.09
111 0.09
112 0.07