Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X6B6

Protein Details
Accession G2X6B6   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-29VAAKKHVPIVKKRTKRFERHQSDRFMRVHydrophilic
NLS Segment(s)
PositionSequence
11-17VKKRTKR
Subcellular Location(s) mito 20.5, mito_nucl 12.166, cyto_nucl 4.333, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG vda:VDAG_05698  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVAAKKHVPIVKKRTKRFERHQSDRFMRVDPSWLKPKGIDNRVRRRFRGTAPMPSIGYGSNKKTKYMMPSGHKAFLVNNVSDVELLLMHNRTFAAEIAHGVSSRKRIDIISRAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.87
4 0.88
5 0.89
6 0.89
7 0.89
8 0.87
9 0.86
10 0.81
11 0.78
12 0.69
13 0.6
14 0.51
15 0.42
16 0.43
17 0.36
18 0.36
19 0.38
20 0.37
21 0.36
22 0.35
23 0.43
24 0.45
25 0.5
26 0.53
27 0.54
28 0.64
29 0.74
30 0.77
31 0.71
32 0.68
33 0.64
34 0.59
35 0.6
36 0.53
37 0.52
38 0.5
39 0.5
40 0.43
41 0.39
42 0.35
43 0.25
44 0.25
45 0.18
46 0.19
47 0.23
48 0.24
49 0.24
50 0.25
51 0.26
52 0.28
53 0.32
54 0.35
55 0.33
56 0.39
57 0.41
58 0.41
59 0.39
60 0.34
61 0.28
62 0.27
63 0.25
64 0.18
65 0.17
66 0.15
67 0.16
68 0.15
69 0.14
70 0.08
71 0.05
72 0.06
73 0.06
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.08
80 0.08
81 0.08
82 0.08
83 0.09
84 0.1
85 0.11
86 0.11
87 0.11
88 0.13
89 0.16
90 0.17
91 0.17
92 0.17
93 0.18
94 0.25
95 0.33
96 0.41
97 0.44
98 0.49
99 0.49
100 0.49
101 0.5
102 0.45
103 0.45
104 0.39
105 0.37
106 0.4
107 0.47
108 0.53
109 0.52
110 0.54
111 0.48