Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165PMI7

Protein Details
Accession A0A165PMI7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
209-238EIDHGVKHIKRRCRRRRLRLLRTNYWHQAGBasic
NLS Segment(s)
PositionSequence
218-225KRRCRRRR
Subcellular Location(s) mito 18, cyto 5, plas 2
Family & Domain DBs
Amino Acid Sequences MSSARKVALDKTALRTLVQLMFLEAEMGKGFVICCSTVSSNWTKPQQRFPGLTGFGSTVYREVKWEVQWQRHESPCEPRRPLATEDAWFIFAQESAGCGGGLSQKRAITTNSQILTAFRLDMQHMWRLGTATKDSPPQIDPTWVVPCRSGPQDRTSSDPQPYEPGTCLTALETPSHPNFICVQDEPQKGVASNSAELGGLPSRIQVGVEIDHGVKHIKRRCRRRRLRLLRTNYWHQAGIRRLAIVAPPSVTMT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.36
3 0.33
4 0.3
5 0.27
6 0.21
7 0.17
8 0.17
9 0.16
10 0.16
11 0.12
12 0.1
13 0.08
14 0.08
15 0.07
16 0.06
17 0.07
18 0.06
19 0.08
20 0.07
21 0.08
22 0.12
23 0.14
24 0.14
25 0.19
26 0.25
27 0.28
28 0.35
29 0.43
30 0.47
31 0.49
32 0.59
33 0.63
34 0.63
35 0.61
36 0.57
37 0.56
38 0.51
39 0.47
40 0.38
41 0.3
42 0.24
43 0.22
44 0.2
45 0.14
46 0.14
47 0.13
48 0.13
49 0.15
50 0.18
51 0.2
52 0.28
53 0.32
54 0.38
55 0.44
56 0.49
57 0.53
58 0.54
59 0.56
60 0.5
61 0.54
62 0.54
63 0.56
64 0.52
65 0.48
66 0.47
67 0.47
68 0.47
69 0.42
70 0.38
71 0.31
72 0.31
73 0.29
74 0.27
75 0.22
76 0.2
77 0.14
78 0.11
79 0.1
80 0.07
81 0.06
82 0.05
83 0.06
84 0.05
85 0.05
86 0.05
87 0.1
88 0.12
89 0.12
90 0.14
91 0.15
92 0.15
93 0.17
94 0.18
95 0.17
96 0.2
97 0.24
98 0.22
99 0.22
100 0.22
101 0.21
102 0.21
103 0.17
104 0.13
105 0.07
106 0.08
107 0.08
108 0.1
109 0.11
110 0.13
111 0.13
112 0.13
113 0.12
114 0.13
115 0.13
116 0.12
117 0.12
118 0.11
119 0.12
120 0.14
121 0.14
122 0.15
123 0.16
124 0.17
125 0.16
126 0.16
127 0.16
128 0.16
129 0.22
130 0.21
131 0.21
132 0.18
133 0.19
134 0.2
135 0.23
136 0.24
137 0.21
138 0.25
139 0.31
140 0.31
141 0.36
142 0.38
143 0.38
144 0.37
145 0.36
146 0.31
147 0.3
148 0.3
149 0.25
150 0.21
151 0.18
152 0.16
153 0.15
154 0.14
155 0.11
156 0.12
157 0.12
158 0.13
159 0.12
160 0.15
161 0.16
162 0.19
163 0.18
164 0.17
165 0.19
166 0.19
167 0.21
168 0.18
169 0.22
170 0.28
171 0.29
172 0.3
173 0.3
174 0.28
175 0.25
176 0.25
177 0.24
178 0.18
179 0.17
180 0.15
181 0.14
182 0.13
183 0.12
184 0.14
185 0.11
186 0.09
187 0.08
188 0.08
189 0.08
190 0.08
191 0.09
192 0.08
193 0.09
194 0.09
195 0.11
196 0.12
197 0.11
198 0.11
199 0.12
200 0.15
201 0.15
202 0.23
203 0.29
204 0.38
205 0.48
206 0.59
207 0.7
208 0.78
209 0.87
210 0.9
211 0.94
212 0.95
213 0.96
214 0.95
215 0.94
216 0.93
217 0.9
218 0.87
219 0.82
220 0.74
221 0.66
222 0.58
223 0.56
224 0.51
225 0.49
226 0.42
227 0.36
228 0.33
229 0.3
230 0.32
231 0.26
232 0.23
233 0.17