Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A165U8F0

Protein Details
Accession A0A165U8F0    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAKSKNHTNHNQNRKAHRNGIHydrophilic
NLS Segment(s)
PositionSequence
14-44RKAHRNGIKKPTSHRTRSFKGVEPKFRRNAK
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNRKAHRNGIKKPTSHRTRSFKGVEPKFRRNAKYALLGSRKARLEAET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.8
3 0.79
4 0.78
5 0.77
6 0.77
7 0.79
8 0.75
9 0.7
10 0.7
11 0.71
12 0.69
13 0.66
14 0.66
15 0.64
16 0.61
17 0.65
18 0.62
19 0.58
20 0.6
21 0.61
22 0.63
23 0.63
24 0.66
25 0.68
26 0.71
27 0.67
28 0.62
29 0.59
30 0.52
31 0.54
32 0.5
33 0.51
34 0.49
35 0.51
36 0.49
37 0.52
38 0.49
39 0.42