Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165TPN8

Protein Details
Accession A0A165TPN8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
94-121QDPAHFAHPPKPKKKIRGHGPKVQLGKRBasic
NLS Segment(s)
PositionSequence
102-129PPKPKKKIRGHGPKVQLGKRIRSKRRRS
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR039603  Fyv4  
IPR019083  IGR_protein_motif  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF09597  IGR  
Amino Acid Sequences MSSWLGLKPISLFPRFCRTLINTAPLRPVPPTRGFIATPEDFLKAIGRSADTKVKAESWADLWALNRMRLKKEGVDTRDRRYILWCMGKYRLGQDPAHFAHPPKPKKKIRGHGPKVQLGKRIRSKRRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.42
3 0.4
4 0.39
5 0.38
6 0.43
7 0.44
8 0.47
9 0.41
10 0.4
11 0.44
12 0.39
13 0.36
14 0.31
15 0.3
16 0.29
17 0.31
18 0.32
19 0.3
20 0.32
21 0.31
22 0.3
23 0.33
24 0.27
25 0.25
26 0.23
27 0.21
28 0.18
29 0.18
30 0.18
31 0.11
32 0.11
33 0.1
34 0.1
35 0.11
36 0.14
37 0.19
38 0.18
39 0.19
40 0.19
41 0.2
42 0.2
43 0.18
44 0.16
45 0.12
46 0.12
47 0.11
48 0.11
49 0.1
50 0.14
51 0.14
52 0.15
53 0.17
54 0.17
55 0.19
56 0.21
57 0.22
58 0.21
59 0.27
60 0.31
61 0.33
62 0.42
63 0.43
64 0.46
65 0.5
66 0.47
67 0.42
68 0.38
69 0.37
70 0.33
71 0.38
72 0.34
73 0.31
74 0.34
75 0.36
76 0.33
77 0.33
78 0.33
79 0.29
80 0.29
81 0.27
82 0.32
83 0.31
84 0.34
85 0.32
86 0.27
87 0.32
88 0.4
89 0.48
90 0.49
91 0.57
92 0.61
93 0.71
94 0.8
95 0.83
96 0.84
97 0.86
98 0.86
99 0.86
100 0.85
101 0.82
102 0.8
103 0.74
104 0.72
105 0.66
106 0.68
107 0.69
108 0.72
109 0.75