Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165MRX2

Protein Details
Accession A0A165MRX2    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
192-214FCVVRNPKSWRRRVVKRDASRAHHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 8, nucl 7, mito 6, cyto 2, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPARKSPHCRTCGTPMAGHKRPNRVPVCPVQNPVPAAPEPIPRRGAPLRRRAVEPEPGPDLRLPLNGHWRNPNWVDPVPRVQVEDDRSNHSSWVSTEVDSDSSSSDDGSQDGSEENFLQDDDDDVRSISALSSSSSSSSSARSSSSSASASSAGSSLSQLVGKCVPLASVWAAPTRDIPAISHAANKAGVDFCVVRNPKSWRRRVVKRDASRAHGDGLERQNSWWLVMGQDSRAVTGLIAKTEPDAGGQEDEEQDARTSGLVGAYPIHHSYLRPTFLDVLIAGAVGGFVMFYALSVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.64
4 0.65
5 0.68
6 0.65
7 0.66
8 0.68
9 0.72
10 0.68
11 0.63
12 0.64
13 0.65
14 0.67
15 0.62
16 0.61
17 0.56
18 0.56
19 0.53
20 0.47
21 0.41
22 0.32
23 0.31
24 0.3
25 0.33
26 0.32
27 0.35
28 0.37
29 0.33
30 0.4
31 0.44
32 0.51
33 0.51
34 0.58
35 0.61
36 0.61
37 0.65
38 0.64
39 0.61
40 0.61
41 0.54
42 0.48
43 0.45
44 0.42
45 0.41
46 0.35
47 0.32
48 0.23
49 0.25
50 0.22
51 0.21
52 0.32
53 0.33
54 0.36
55 0.41
56 0.41
57 0.44
58 0.45
59 0.45
60 0.4
61 0.4
62 0.41
63 0.37
64 0.41
65 0.38
66 0.36
67 0.32
68 0.28
69 0.3
70 0.31
71 0.34
72 0.3
73 0.33
74 0.35
75 0.34
76 0.33
77 0.28
78 0.24
79 0.17
80 0.21
81 0.16
82 0.14
83 0.15
84 0.15
85 0.15
86 0.15
87 0.14
88 0.09
89 0.08
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.06
97 0.06
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.06
104 0.06
105 0.05
106 0.05
107 0.06
108 0.07
109 0.07
110 0.07
111 0.07
112 0.07
113 0.07
114 0.07
115 0.06
116 0.05
117 0.04
118 0.05
119 0.06
120 0.06
121 0.07
122 0.07
123 0.09
124 0.09
125 0.1
126 0.1
127 0.1
128 0.1
129 0.11
130 0.12
131 0.11
132 0.13
133 0.12
134 0.11
135 0.11
136 0.11
137 0.1
138 0.09
139 0.08
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.06
146 0.06
147 0.07
148 0.08
149 0.08
150 0.08
151 0.07
152 0.07
153 0.05
154 0.07
155 0.07
156 0.08
157 0.08
158 0.11
159 0.11
160 0.11
161 0.12
162 0.13
163 0.12
164 0.11
165 0.11
166 0.12
167 0.14
168 0.14
169 0.16
170 0.14
171 0.14
172 0.15
173 0.14
174 0.12
175 0.1
176 0.1
177 0.09
178 0.1
179 0.09
180 0.17
181 0.18
182 0.17
183 0.23
184 0.3
185 0.38
186 0.47
187 0.54
188 0.56
189 0.64
190 0.74
191 0.78
192 0.81
193 0.82
194 0.81
195 0.85
196 0.79
197 0.76
198 0.7
199 0.62
200 0.52
201 0.44
202 0.36
203 0.33
204 0.34
205 0.31
206 0.27
207 0.26
208 0.28
209 0.26
210 0.25
211 0.2
212 0.15
213 0.12
214 0.16
215 0.17
216 0.13
217 0.16
218 0.16
219 0.14
220 0.14
221 0.13
222 0.1
223 0.14
224 0.14
225 0.12
226 0.12
227 0.12
228 0.12
229 0.13
230 0.13
231 0.09
232 0.1
233 0.1
234 0.11
235 0.12
236 0.13
237 0.12
238 0.13
239 0.13
240 0.13
241 0.12
242 0.11
243 0.11
244 0.09
245 0.09
246 0.08
247 0.08
248 0.08
249 0.08
250 0.09
251 0.1
252 0.13
253 0.13
254 0.15
255 0.15
256 0.15
257 0.22
258 0.28
259 0.31
260 0.28
261 0.3
262 0.31
263 0.3
264 0.31
265 0.24
266 0.18
267 0.14
268 0.13
269 0.1
270 0.07
271 0.06
272 0.04
273 0.04
274 0.02
275 0.02
276 0.03
277 0.03