Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A165MF94

Protein Details
Accession A0A165MF94    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
146-177ASSQIRPRKQCSNKGKKHARPKNAKGKGKAVQHydrophilic
NLS Segment(s)
PositionSequence
157-175SNKGKKHARPKNAKGKGKA
Subcellular Location(s) nucl 21.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
Amino Acid Sequences MPPESSLSAALEISSAPHHSLFNSTLVEAFSVAGCDFMSFYCTPREKAEHLRKLIQWKILEGLVKITGEQDVRMEYVKYEQEMIAQRGIVLHGWLLSEFKNLSELSTSLPPLKAQYQALVDGMCHWDKATPDEHEAARKGYSERLASSQIRPRKQCSNKGKKHARPKNAKGKGKAVQRDEQGNRGASDIDRDDEDEDENENENDHPQKRHHRDGAVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.1
4 0.11
5 0.12
6 0.12
7 0.16
8 0.17
9 0.18
10 0.18
11 0.17
12 0.17
13 0.17
14 0.16
15 0.13
16 0.11
17 0.08
18 0.08
19 0.07
20 0.07
21 0.06
22 0.06
23 0.06
24 0.06
25 0.1
26 0.09
27 0.11
28 0.19
29 0.21
30 0.23
31 0.27
32 0.31
33 0.32
34 0.43
35 0.52
36 0.53
37 0.55
38 0.59
39 0.58
40 0.62
41 0.61
42 0.57
43 0.46
44 0.39
45 0.36
46 0.33
47 0.3
48 0.22
49 0.2
50 0.15
51 0.14
52 0.13
53 0.11
54 0.11
55 0.1
56 0.1
57 0.09
58 0.08
59 0.09
60 0.1
61 0.09
62 0.08
63 0.11
64 0.12
65 0.12
66 0.12
67 0.11
68 0.15
69 0.18
70 0.19
71 0.17
72 0.15
73 0.15
74 0.14
75 0.14
76 0.1
77 0.06
78 0.05
79 0.04
80 0.04
81 0.05
82 0.05
83 0.05
84 0.06
85 0.06
86 0.06
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.09
93 0.1
94 0.11
95 0.1
96 0.1
97 0.1
98 0.11
99 0.12
100 0.12
101 0.11
102 0.13
103 0.13
104 0.13
105 0.13
106 0.12
107 0.1
108 0.09
109 0.11
110 0.09
111 0.08
112 0.07
113 0.08
114 0.09
115 0.11
116 0.14
117 0.13
118 0.16
119 0.18
120 0.19
121 0.21
122 0.21
123 0.2
124 0.18
125 0.17
126 0.16
127 0.16
128 0.19
129 0.17
130 0.18
131 0.19
132 0.24
133 0.25
134 0.29
135 0.34
136 0.38
137 0.43
138 0.45
139 0.47
140 0.53
141 0.59
142 0.64
143 0.68
144 0.72
145 0.74
146 0.82
147 0.88
148 0.86
149 0.9
150 0.89
151 0.88
152 0.88
153 0.89
154 0.89
155 0.89
156 0.88
157 0.82
158 0.81
159 0.78
160 0.76
161 0.74
162 0.68
163 0.65
164 0.61
165 0.65
166 0.59
167 0.57
168 0.52
169 0.46
170 0.4
171 0.34
172 0.31
173 0.22
174 0.24
175 0.2
176 0.18
177 0.17
178 0.18
179 0.18
180 0.17
181 0.19
182 0.15
183 0.15
184 0.15
185 0.16
186 0.15
187 0.15
188 0.14
189 0.17
190 0.23
191 0.25
192 0.28
193 0.34
194 0.46
195 0.53
196 0.63
197 0.66