Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2X5B1

Protein Details
Accession G2X5B1   
Localization Confidence Low
Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
100-122GEPRCPPPPPPPHPRICKKNKGTBasic
NLS Segment(s)
Subcellular Location(s) extr 23, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR000026  Gua-sp_ribonuclease_N1/T1/U2  
IPR016191  Ribonuclease/ribotoxin  
Gene Ontology GO:0016829  F:lyase activity  
GO:0046589  F:ribonuclease T1 activity  
GO:0003723  F:RNA binding  
GO:0004521  F:RNA endonuclease activity  
KEGG vda:VDAG_05416  -  
Pfam View protein in Pfam  
PF00545  Ribonuclease  
Amino Acid Sequences MQFKALIVSLLAVAAQAAPASPNEERSAIEKRATTCGSTYYTTAQVNAAANAACQHVRAGTQAGSSNYPHRYNNYEGFNFKASGPWQEFPLRSSGVYTGGEPRCPPPPPPPHPRICKKNKGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.03
4 0.03
5 0.04
6 0.04
7 0.09
8 0.09
9 0.12
10 0.14
11 0.15
12 0.16
13 0.19
14 0.25
15 0.23
16 0.26
17 0.26
18 0.26
19 0.32
20 0.32
21 0.29
22 0.23
23 0.24
24 0.24
25 0.22
26 0.21
27 0.17
28 0.2
29 0.19
30 0.18
31 0.16
32 0.15
33 0.14
34 0.13
35 0.11
36 0.08
37 0.08
38 0.08
39 0.09
40 0.06
41 0.06
42 0.06
43 0.06
44 0.06
45 0.07
46 0.07
47 0.07
48 0.08
49 0.1
50 0.11
51 0.12
52 0.13
53 0.16
54 0.18
55 0.2
56 0.2
57 0.21
58 0.24
59 0.27
60 0.31
61 0.33
62 0.31
63 0.3
64 0.32
65 0.31
66 0.28
67 0.23
68 0.21
69 0.17
70 0.2
71 0.24
72 0.22
73 0.23
74 0.26
75 0.27
76 0.24
77 0.27
78 0.22
79 0.19
80 0.19
81 0.17
82 0.16
83 0.16
84 0.16
85 0.21
86 0.22
87 0.23
88 0.23
89 0.25
90 0.28
91 0.3
92 0.32
93 0.34
94 0.43
95 0.49
96 0.58
97 0.63
98 0.67
99 0.76
100 0.83
101 0.84
102 0.84