Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2WQ93

Protein Details
Accession G2WQ93    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-55RANANFRRDLRRNERKQHRAEKEEABasic
NLS Segment(s)
Subcellular Location(s) mito 6extr 6, cyto 5, mito_nucl 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002056  MAS20  
IPR023392  Tom20_dom_sf  
Gene Ontology GO:0005742  C:mitochondrial outer membrane translocase complex  
GO:0006605  P:protein targeting  
KEGG vda:VDAG_00535  -  
Pfam View protein in Pfam  
PF02064  MAS20  
Amino Acid Sequences MVQSSTIVTASVAAAATGVVAYLFYFDYQRRANANFRRDLRRNERKQHRAEKEEAQLETVRQRQAIAQAVVQAKEEGFPEDVEGREAYFLQQVSEGETLAADPNHVVEAALAFYKGLKVYPTPNDLISIYDKTVPKPVLDILAEMIASDSDLKISSGGQGSYTGSSGPNLSDMPTVGLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.05
3 0.05
4 0.04
5 0.04
6 0.03
7 0.03
8 0.03
9 0.04
10 0.04
11 0.05
12 0.08
13 0.09
14 0.14
15 0.16
16 0.2
17 0.22
18 0.26
19 0.35
20 0.41
21 0.47
22 0.5
23 0.54
24 0.6
25 0.62
26 0.68
27 0.7
28 0.73
29 0.75
30 0.78
31 0.83
32 0.83
33 0.87
34 0.88
35 0.86
36 0.81
37 0.76
38 0.72
39 0.69
40 0.64
41 0.54
42 0.46
43 0.38
44 0.33
45 0.33
46 0.29
47 0.23
48 0.18
49 0.19
50 0.17
51 0.21
52 0.24
53 0.2
54 0.17
55 0.21
56 0.22
57 0.22
58 0.21
59 0.17
60 0.12
61 0.12
62 0.12
63 0.08
64 0.08
65 0.07
66 0.08
67 0.09
68 0.09
69 0.09
70 0.09
71 0.08
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.06
78 0.07
79 0.07
80 0.09
81 0.09
82 0.09
83 0.07
84 0.07
85 0.07
86 0.07
87 0.07
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.05
103 0.05
104 0.06
105 0.07
106 0.12
107 0.16
108 0.2
109 0.21
110 0.21
111 0.22
112 0.21
113 0.22
114 0.21
115 0.19
116 0.16
117 0.2
118 0.2
119 0.2
120 0.26
121 0.24
122 0.21
123 0.21
124 0.21
125 0.2
126 0.19
127 0.19
128 0.14
129 0.14
130 0.13
131 0.11
132 0.1
133 0.06
134 0.06
135 0.06
136 0.05
137 0.05
138 0.06
139 0.06
140 0.06
141 0.06
142 0.09
143 0.11
144 0.11
145 0.11
146 0.12
147 0.14
148 0.14
149 0.14
150 0.12
151 0.11
152 0.11
153 0.12
154 0.11
155 0.11
156 0.11
157 0.12
158 0.12
159 0.12