Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2X260

Protein Details
Accession G2X260    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
133-155DEFSKSAKLRRKAAKRKAKLLAEHydrophilic
192-216REELRQAMRSERKRKIKESNYLKSMHydrophilic
NLS Segment(s)
PositionSequence
138-151SAKLRRKAAKRKAK
202-206ERKRK
Subcellular Location(s) mito 21, mito_nucl 13.833, cyto_mito 11.333, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG vda:VDAG_04384  -  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MICRTCLRRAATTLPLRTVAPIPLARPFSISASTRSSPAGSLGTSEASPASSTAEPTATPTLSTPIDLPSAAAAKPVREPSSCKAGTVLNGLNYFKGKTDPVALADEEYPDWLWDCLVFKAKEDADADAGAADEFSKSAKLRRKAAKRKAKLLAEGGIDALAPKVPLFQQSINLPGEEGGSVEDNLMAAGKREELRQAMRSERKRKIKESNYLKSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.42
4 0.4
5 0.36
6 0.28
7 0.25
8 0.23
9 0.22
10 0.26
11 0.29
12 0.27
13 0.27
14 0.27
15 0.24
16 0.27
17 0.27
18 0.24
19 0.28
20 0.29
21 0.28
22 0.28
23 0.25
24 0.21
25 0.21
26 0.19
27 0.12
28 0.13
29 0.13
30 0.13
31 0.12
32 0.12
33 0.1
34 0.09
35 0.09
36 0.08
37 0.1
38 0.09
39 0.1
40 0.11
41 0.11
42 0.11
43 0.14
44 0.16
45 0.12
46 0.12
47 0.12
48 0.14
49 0.14
50 0.15
51 0.12
52 0.11
53 0.12
54 0.11
55 0.11
56 0.09
57 0.1
58 0.09
59 0.12
60 0.11
61 0.11
62 0.14
63 0.17
64 0.19
65 0.18
66 0.23
67 0.23
68 0.32
69 0.31
70 0.28
71 0.26
72 0.25
73 0.25
74 0.24
75 0.22
76 0.15
77 0.17
78 0.17
79 0.16
80 0.15
81 0.15
82 0.11
83 0.11
84 0.09
85 0.09
86 0.11
87 0.11
88 0.12
89 0.13
90 0.13
91 0.12
92 0.12
93 0.12
94 0.09
95 0.09
96 0.07
97 0.05
98 0.06
99 0.05
100 0.04
101 0.05
102 0.06
103 0.07
104 0.12
105 0.12
106 0.12
107 0.16
108 0.16
109 0.19
110 0.18
111 0.18
112 0.14
113 0.14
114 0.13
115 0.09
116 0.09
117 0.06
118 0.05
119 0.04
120 0.03
121 0.03
122 0.03
123 0.05
124 0.06
125 0.12
126 0.21
127 0.26
128 0.35
129 0.45
130 0.56
131 0.65
132 0.75
133 0.8
134 0.79
135 0.83
136 0.83
137 0.77
138 0.71
139 0.63
140 0.57
141 0.47
142 0.4
143 0.31
144 0.22
145 0.17
146 0.13
147 0.1
148 0.06
149 0.05
150 0.04
151 0.06
152 0.06
153 0.09
154 0.13
155 0.14
156 0.17
157 0.19
158 0.24
159 0.23
160 0.22
161 0.2
162 0.16
163 0.16
164 0.12
165 0.1
166 0.07
167 0.08
168 0.08
169 0.08
170 0.08
171 0.07
172 0.07
173 0.07
174 0.06
175 0.06
176 0.07
177 0.1
178 0.12
179 0.13
180 0.17
181 0.21
182 0.26
183 0.31
184 0.34
185 0.41
186 0.5
187 0.59
188 0.65
189 0.7
190 0.76
191 0.78
192 0.83
193 0.84
194 0.84
195 0.85
196 0.86