Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A161W865

Protein Details
Accession A0A161W865    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-75QSVRLGGWRWPKRNKWQGVRVRGTSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, extr 3, mito 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences LNARATVASLSFGVFPIAFIASWIRASVFFISYLTMVEAVVLLKLRSGDHQSVRLGGWRWPKRNKWQGVRVRGTSNC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.08
5 0.07
6 0.07
7 0.08
8 0.08
9 0.08
10 0.08
11 0.08
12 0.07
13 0.09
14 0.1
15 0.09
16 0.08
17 0.08
18 0.09
19 0.08
20 0.08
21 0.07
22 0.06
23 0.05
24 0.04
25 0.04
26 0.04
27 0.04
28 0.04
29 0.03
30 0.04
31 0.05
32 0.05
33 0.07
34 0.12
35 0.16
36 0.18
37 0.21
38 0.21
39 0.22
40 0.22
41 0.24
42 0.22
43 0.23
44 0.31
45 0.36
46 0.44
47 0.52
48 0.6
49 0.67
50 0.76
51 0.81
52 0.8
53 0.82
54 0.84
55 0.85
56 0.85
57 0.79