Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A162NTQ7

Protein Details
Accession A0A162NTQ7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-42ARLISRTRESRRGIKKRRDKMSVSAHydrophilic
NLS Segment(s)
PositionSequence
25-36RESRRGIKKRRD
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR013901  Anthrone_oxy  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF08592  Anthrone_oxy  
Amino Acid Sequences LTSNHATTSSRCTTASSARLISRTRESRRGIKKRRDKMSVSAYVAAFGRAPPATWALGAGLVVTSSLLFGNIGLTLTGPLPIIRDQLGTSSLSAKQKVRVWRLFFDEATKYVIVGTGLTAALHLGAFALGDSAVSRRLAVMSALSSVITMPYTAMVIMPTNKALITLDDKVALSEMDRRKSGKLIEKWDRLHKVRFLMYGSAWLCGLTALMAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.39
3 0.35
4 0.34
5 0.35
6 0.39
7 0.38
8 0.39
9 0.41
10 0.46
11 0.49
12 0.53
13 0.57
14 0.62
15 0.71
16 0.78
17 0.78
18 0.8
19 0.84
20 0.85
21 0.89
22 0.87
23 0.8
24 0.78
25 0.77
26 0.74
27 0.67
28 0.61
29 0.51
30 0.45
31 0.4
32 0.32
33 0.22
34 0.14
35 0.14
36 0.09
37 0.1
38 0.1
39 0.12
40 0.11
41 0.11
42 0.11
43 0.09
44 0.09
45 0.08
46 0.07
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.08
70 0.08
71 0.08
72 0.08
73 0.09
74 0.1
75 0.09
76 0.09
77 0.1
78 0.13
79 0.15
80 0.17
81 0.17
82 0.21
83 0.25
84 0.32
85 0.38
86 0.4
87 0.42
88 0.42
89 0.47
90 0.44
91 0.4
92 0.35
93 0.29
94 0.23
95 0.22
96 0.19
97 0.13
98 0.1
99 0.11
100 0.08
101 0.07
102 0.06
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.04
109 0.03
110 0.03
111 0.02
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.03
119 0.03
120 0.05
121 0.05
122 0.05
123 0.05
124 0.06
125 0.06
126 0.06
127 0.07
128 0.06
129 0.07
130 0.07
131 0.06
132 0.06
133 0.06
134 0.06
135 0.05
136 0.05
137 0.04
138 0.04
139 0.04
140 0.04
141 0.04
142 0.05
143 0.06
144 0.08
145 0.08
146 0.09
147 0.09
148 0.09
149 0.09
150 0.09
151 0.1
152 0.14
153 0.15
154 0.15
155 0.16
156 0.16
157 0.16
158 0.16
159 0.13
160 0.1
161 0.16
162 0.21
163 0.24
164 0.26
165 0.28
166 0.29
167 0.34
168 0.4
169 0.42
170 0.44
171 0.5
172 0.58
173 0.64
174 0.68
175 0.73
176 0.75
177 0.7
178 0.69
179 0.64
180 0.6
181 0.56
182 0.54
183 0.47
184 0.41
185 0.37
186 0.38
187 0.33
188 0.28
189 0.24
190 0.21
191 0.17
192 0.14
193 0.14
194 0.06