Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2XHS3

Protein Details
Accession G2XHS3    Localization Confidence High Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
166-191QRRLEETRRRKAEKKARKRGELPPETBasic
NLS Segment(s)
PositionSequence
99-151GARRPRGEAKRRRDEQEEKRRELEREKARMGEELRRRRAEEDERFRREAEEKR
170-198EETRRRKAEKKARKRGELPPETESKDAPK
204-205GK
Subcellular Location(s) nucl 18.5, cyto_nucl 11, mito 4, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR036869  J_dom_sf  
KEGG vda:VDAG_09827  -  
Pfam View protein in Pfam  
PF00226  DnaJ  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
CDD cd06257  DnaJ  
Amino Acid Sequences MDTKDLTQKATEYASQHIDLYALIALDPATTDAKQIHRAWRKSSLLHHPDKAGDAFDPEKWALLESARDVLLDATARGAYDRGREAQALRAAERAQVQGARRPRGEAKRRRDEQEEKRRELEREKARMGEELRRRRAEEDERFRREAEEKRNREEDEGDERIQELQRRLEETRRRKAEKKARKRGELPPETESKDAPKTNGGEGKAPKWEDLKARMIAVQKKRDAAKLAAAQETAAGTAEEDDTTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.27
4 0.24
5 0.21
6 0.17
7 0.16
8 0.12
9 0.08
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.07
16 0.08
17 0.08
18 0.1
19 0.13
20 0.16
21 0.24
22 0.28
23 0.36
24 0.44
25 0.49
26 0.52
27 0.58
28 0.59
29 0.56
30 0.6
31 0.6
32 0.6
33 0.62
34 0.59
35 0.52
36 0.49
37 0.47
38 0.41
39 0.31
40 0.22
41 0.19
42 0.18
43 0.16
44 0.19
45 0.16
46 0.16
47 0.15
48 0.15
49 0.12
50 0.11
51 0.12
52 0.1
53 0.12
54 0.11
55 0.1
56 0.1
57 0.09
58 0.09
59 0.08
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.07
66 0.07
67 0.09
68 0.11
69 0.12
70 0.14
71 0.15
72 0.15
73 0.2
74 0.23
75 0.22
76 0.2
77 0.2
78 0.19
79 0.2
80 0.2
81 0.16
82 0.13
83 0.15
84 0.15
85 0.19
86 0.25
87 0.27
88 0.26
89 0.29
90 0.35
91 0.42
92 0.51
93 0.55
94 0.59
95 0.65
96 0.7
97 0.71
98 0.71
99 0.71
100 0.72
101 0.73
102 0.71
103 0.64
104 0.64
105 0.62
106 0.56
107 0.5
108 0.49
109 0.46
110 0.44
111 0.42
112 0.39
113 0.37
114 0.38
115 0.36
116 0.35
117 0.36
118 0.39
119 0.44
120 0.44
121 0.45
122 0.43
123 0.47
124 0.49
125 0.49
126 0.51
127 0.55
128 0.58
129 0.58
130 0.56
131 0.52
132 0.48
133 0.45
134 0.46
135 0.47
136 0.46
137 0.5
138 0.55
139 0.53
140 0.5
141 0.45
142 0.38
143 0.35
144 0.34
145 0.29
146 0.24
147 0.24
148 0.24
149 0.24
150 0.23
151 0.19
152 0.19
153 0.21
154 0.24
155 0.26
156 0.33
157 0.41
158 0.46
159 0.54
160 0.59
161 0.64
162 0.66
163 0.75
164 0.77
165 0.79
166 0.81
167 0.82
168 0.82
169 0.84
170 0.85
171 0.83
172 0.83
173 0.8
174 0.73
175 0.66
176 0.62
177 0.57
178 0.51
179 0.43
180 0.36
181 0.35
182 0.32
183 0.3
184 0.3
185 0.29
186 0.34
187 0.38
188 0.34
189 0.34
190 0.36
191 0.37
192 0.39
193 0.38
194 0.35
195 0.32
196 0.35
197 0.34
198 0.37
199 0.4
200 0.35
201 0.35
202 0.36
203 0.41
204 0.46
205 0.48
206 0.51
207 0.48
208 0.52
209 0.55
210 0.56
211 0.54
212 0.48
213 0.48
214 0.46
215 0.46
216 0.43
217 0.4
218 0.34
219 0.3
220 0.27
221 0.19
222 0.13
223 0.09
224 0.07
225 0.08
226 0.09