Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166QUS8

Protein Details
Accession A0A166QUS8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
77-102NLMPAALKPKPRKQLKRNPQQTSYTSHydrophilic
NLS Segment(s)
PositionSequence
86-89KPRK
Subcellular Location(s) nucl 10, mito 9, cyto 5.5, cyto_pero 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045054  P4HA-like  
IPR006620  Pro_4_hyd_alph  
IPR044862  Pro_4_hyd_alph_FE2OG_OXY  
Gene Ontology GO:0051213  F:dioxygenase activity  
GO:0005506  F:iron ion binding  
GO:0031418  F:L-ascorbic acid binding  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
Pfam View protein in Pfam  
PF13640  2OG-FeII_Oxy_3  
Amino Acid Sequences LMLRLTTRGHNASFVPVDDTFNPLMTRVLKNAVFCFLQLQFNNLQERQRHRIITQHRVQHQCVWRRTHPRLTMSLSNLMPAALKPKPRKQLKRNPQQTSYTSNDVPIPADFLSVPLPEDAPPVTLKKVDWSTSALPENGLLYAVVLDNVLTPQECAQLIRMAEDSATDRGDDGDEPWQPAMVNIGPGWEILEPEYRNSDRIIWDQQEVVDRLWERCRLAPGLEEQLRGVEGSSKPEKGEETRWVFDRFNKRMRFLKYQKGQFFRPHCDGSYGEEGEDGTVYQTHYTVHLYLNDSVAEVGKDKADLVGGATTFLSTDEKRRVDVDPKAGRVLIFQHRRLYHCGDDVVKGTKYTMRTDILYQLIRTKIKAEGDADCEGQRDSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.27
3 0.24
4 0.26
5 0.24
6 0.27
7 0.22
8 0.22
9 0.21
10 0.18
11 0.2
12 0.21
13 0.23
14 0.21
15 0.27
16 0.27
17 0.3
18 0.31
19 0.31
20 0.27
21 0.25
22 0.26
23 0.22
24 0.28
25 0.25
26 0.27
27 0.27
28 0.31
29 0.37
30 0.35
31 0.38
32 0.38
33 0.45
34 0.49
35 0.51
36 0.51
37 0.46
38 0.53
39 0.56
40 0.59
41 0.6
42 0.61
43 0.63
44 0.66
45 0.67
46 0.67
47 0.68
48 0.67
49 0.66
50 0.65
51 0.65
52 0.69
53 0.74
54 0.74
55 0.72
56 0.68
57 0.67
58 0.66
59 0.63
60 0.57
61 0.56
62 0.46
63 0.4
64 0.35
65 0.29
66 0.23
67 0.16
68 0.18
69 0.15
70 0.23
71 0.3
72 0.39
73 0.49
74 0.59
75 0.69
76 0.75
77 0.83
78 0.86
79 0.9
80 0.92
81 0.89
82 0.85
83 0.81
84 0.74
85 0.69
86 0.63
87 0.57
88 0.47
89 0.4
90 0.35
91 0.29
92 0.26
93 0.19
94 0.16
95 0.11
96 0.12
97 0.1
98 0.1
99 0.11
100 0.1
101 0.1
102 0.08
103 0.09
104 0.08
105 0.1
106 0.09
107 0.09
108 0.1
109 0.11
110 0.12
111 0.13
112 0.12
113 0.17
114 0.2
115 0.2
116 0.2
117 0.23
118 0.24
119 0.27
120 0.29
121 0.23
122 0.2
123 0.19
124 0.18
125 0.13
126 0.11
127 0.06
128 0.04
129 0.05
130 0.05
131 0.04
132 0.04
133 0.04
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.05
140 0.06
141 0.07
142 0.07
143 0.08
144 0.11
145 0.11
146 0.11
147 0.11
148 0.1
149 0.09
150 0.1
151 0.1
152 0.09
153 0.09
154 0.08
155 0.07
156 0.07
157 0.08
158 0.08
159 0.07
160 0.1
161 0.1
162 0.11
163 0.11
164 0.11
165 0.1
166 0.1
167 0.11
168 0.07
169 0.07
170 0.06
171 0.07
172 0.06
173 0.06
174 0.07
175 0.05
176 0.05
177 0.05
178 0.09
179 0.09
180 0.09
181 0.13
182 0.13
183 0.14
184 0.14
185 0.15
186 0.14
187 0.17
188 0.2
189 0.18
190 0.18
191 0.18
192 0.18
193 0.2
194 0.19
195 0.16
196 0.14
197 0.14
198 0.15
199 0.17
200 0.19
201 0.17
202 0.17
203 0.2
204 0.18
205 0.18
206 0.18
207 0.17
208 0.23
209 0.23
210 0.22
211 0.19
212 0.18
213 0.18
214 0.16
215 0.14
216 0.11
217 0.1
218 0.15
219 0.18
220 0.18
221 0.18
222 0.19
223 0.21
224 0.2
225 0.24
226 0.27
227 0.3
228 0.31
229 0.34
230 0.37
231 0.36
232 0.4
233 0.45
234 0.43
235 0.46
236 0.47
237 0.49
238 0.53
239 0.58
240 0.62
241 0.58
242 0.62
243 0.62
244 0.68
245 0.71
246 0.69
247 0.67
248 0.65
249 0.64
250 0.61
251 0.58
252 0.51
253 0.44
254 0.42
255 0.39
256 0.35
257 0.36
258 0.29
259 0.23
260 0.21
261 0.2
262 0.17
263 0.16
264 0.11
265 0.05
266 0.06
267 0.06
268 0.06
269 0.07
270 0.07
271 0.08
272 0.1
273 0.11
274 0.11
275 0.14
276 0.17
277 0.18
278 0.19
279 0.17
280 0.16
281 0.15
282 0.14
283 0.11
284 0.09
285 0.09
286 0.08
287 0.08
288 0.08
289 0.08
290 0.08
291 0.07
292 0.07
293 0.09
294 0.08
295 0.09
296 0.09
297 0.08
298 0.08
299 0.09
300 0.11
301 0.1
302 0.16
303 0.23
304 0.24
305 0.26
306 0.28
307 0.32
308 0.36
309 0.42
310 0.46
311 0.46
312 0.47
313 0.48
314 0.47
315 0.42
316 0.36
317 0.36
318 0.36
319 0.37
320 0.38
321 0.44
322 0.48
323 0.51
324 0.55
325 0.55
326 0.49
327 0.44
328 0.45
329 0.39
330 0.37
331 0.37
332 0.37
333 0.31
334 0.27
335 0.25
336 0.25
337 0.26
338 0.28
339 0.3
340 0.28
341 0.29
342 0.32
343 0.35
344 0.37
345 0.37
346 0.34
347 0.35
348 0.38
349 0.38
350 0.36
351 0.32
352 0.32
353 0.33
354 0.36
355 0.33
356 0.32
357 0.35
358 0.37
359 0.37
360 0.32
361 0.3