Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A162Q999

Protein Details
Accession A0A162Q999    Localization Confidence High Confidence Score 17.4
NoLS Segment(s)
PositionSequenceProtein Nature
368-395EQEKLEKRLKAEKEERKRRFYEQQRARRBasic
NLS Segment(s)
PositionSequence
183-260TKKEREEMKKEAKKDPKAGARQSSKFQGTARPSSAAPSRNGASANRNGAADRAKDPRAAAKARAATAEEENQKKLKKA
271-298ARPKPGAASAKKKPAPGGALLNARPAPR
374-395KRLKAEKEERKRRFYEQQRARR
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013256  Chromatin_SPT2  
Pfam View protein in Pfam  
PF08243  SPT2  
Amino Acid Sequences MPIGDLLAQISGDKSQSTSPAPSRPPIPPPKRKADDDLRSIVSNKTPRTSTNGTGPSAPSKPADPPRSARPTEKPATTTTGYRGSAGRPSDRSASAPKPVGNGATVARPSSSGARPLNGSSTSRITSTLPSRPSPSAPAAAPKPGVPPKKGSFAEIMARAQQAQTKMGQVGKIQHKPVEKVFTKKEREEMKKEAKKDPKAGARQSSKFQGTARPSSAAPSRNGASANRNGAADRAKDPRAAAKARAATAEEENQKKLKKAAIATTGYTGTARPKPGAASAKKKPAPGGALLNARPAPRYGGSAKRSRYDEEEDDEELDDFIEYDEDEEETGPRYTYDSDGSSDMEAGMDDVWEEEAKAERVARLEDIEQEKLEKRLKAEKEERKRRFYEQQRARR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.16
4 0.2
5 0.26
6 0.29
7 0.37
8 0.41
9 0.43
10 0.46
11 0.48
12 0.54
13 0.58
14 0.64
15 0.66
16 0.71
17 0.77
18 0.79
19 0.79
20 0.78
21 0.78
22 0.76
23 0.72
24 0.7
25 0.62
26 0.57
27 0.54
28 0.47
29 0.44
30 0.41
31 0.37
32 0.37
33 0.35
34 0.35
35 0.42
36 0.45
37 0.42
38 0.44
39 0.46
40 0.43
41 0.43
42 0.44
43 0.41
44 0.37
45 0.35
46 0.27
47 0.24
48 0.31
49 0.38
50 0.42
51 0.42
52 0.45
53 0.53
54 0.6
55 0.61
56 0.6
57 0.58
58 0.61
59 0.62
60 0.6
61 0.53
62 0.48
63 0.5
64 0.46
65 0.4
66 0.35
67 0.36
68 0.32
69 0.31
70 0.29
71 0.25
72 0.29
73 0.3
74 0.31
75 0.27
76 0.3
77 0.32
78 0.32
79 0.33
80 0.34
81 0.34
82 0.35
83 0.36
84 0.34
85 0.32
86 0.32
87 0.3
88 0.24
89 0.21
90 0.16
91 0.17
92 0.17
93 0.15
94 0.14
95 0.13
96 0.14
97 0.18
98 0.18
99 0.22
100 0.22
101 0.23
102 0.24
103 0.25
104 0.27
105 0.24
106 0.24
107 0.19
108 0.22
109 0.21
110 0.2
111 0.2
112 0.18
113 0.21
114 0.24
115 0.27
116 0.27
117 0.28
118 0.32
119 0.32
120 0.33
121 0.32
122 0.3
123 0.27
124 0.24
125 0.27
126 0.25
127 0.25
128 0.24
129 0.21
130 0.25
131 0.29
132 0.33
133 0.29
134 0.34
135 0.35
136 0.43
137 0.43
138 0.38
139 0.34
140 0.32
141 0.34
142 0.29
143 0.27
144 0.2
145 0.2
146 0.18
147 0.16
148 0.16
149 0.13
150 0.12
151 0.13
152 0.12
153 0.14
154 0.15
155 0.16
156 0.15
157 0.21
158 0.28
159 0.31
160 0.31
161 0.33
162 0.34
163 0.36
164 0.37
165 0.38
166 0.33
167 0.34
168 0.4
169 0.45
170 0.48
171 0.47
172 0.51
173 0.51
174 0.56
175 0.56
176 0.57
177 0.59
178 0.59
179 0.62
180 0.63
181 0.63
182 0.61
183 0.61
184 0.59
185 0.56
186 0.58
187 0.59
188 0.58
189 0.57
190 0.54
191 0.51
192 0.5
193 0.43
194 0.37
195 0.34
196 0.32
197 0.3
198 0.31
199 0.3
200 0.27
201 0.25
202 0.27
203 0.3
204 0.26
205 0.23
206 0.22
207 0.21
208 0.2
209 0.22
210 0.2
211 0.21
212 0.21
213 0.23
214 0.21
215 0.2
216 0.19
217 0.2
218 0.21
219 0.18
220 0.18
221 0.2
222 0.2
223 0.21
224 0.22
225 0.25
226 0.28
227 0.28
228 0.27
229 0.28
230 0.3
231 0.29
232 0.3
233 0.26
234 0.22
235 0.22
236 0.26
237 0.26
238 0.25
239 0.27
240 0.29
241 0.3
242 0.29
243 0.29
244 0.27
245 0.26
246 0.28
247 0.32
248 0.35
249 0.36
250 0.35
251 0.35
252 0.31
253 0.27
254 0.23
255 0.18
256 0.16
257 0.18
258 0.18
259 0.17
260 0.18
261 0.19
262 0.25
263 0.33
264 0.35
265 0.4
266 0.45
267 0.54
268 0.57
269 0.57
270 0.53
271 0.48
272 0.45
273 0.4
274 0.38
275 0.33
276 0.36
277 0.35
278 0.36
279 0.34
280 0.31
281 0.28
282 0.23
283 0.22
284 0.17
285 0.21
286 0.23
287 0.29
288 0.35
289 0.42
290 0.44
291 0.46
292 0.48
293 0.47
294 0.47
295 0.46
296 0.44
297 0.42
298 0.42
299 0.37
300 0.35
301 0.32
302 0.27
303 0.2
304 0.16
305 0.11
306 0.07
307 0.06
308 0.05
309 0.05
310 0.05
311 0.06
312 0.06
313 0.06
314 0.07
315 0.07
316 0.09
317 0.1
318 0.09
319 0.09
320 0.11
321 0.12
322 0.14
323 0.16
324 0.16
325 0.17
326 0.19
327 0.2
328 0.18
329 0.17
330 0.15
331 0.12
332 0.1
333 0.08
334 0.07
335 0.05
336 0.05
337 0.05
338 0.06
339 0.06
340 0.06
341 0.07
342 0.1
343 0.11
344 0.13
345 0.14
346 0.15
347 0.17
348 0.19
349 0.2
350 0.2
351 0.2
352 0.26
353 0.29
354 0.29
355 0.28
356 0.3
357 0.31
358 0.34
359 0.39
360 0.34
361 0.35
362 0.42
363 0.47
364 0.54
365 0.62
366 0.67
367 0.72
368 0.81
369 0.85
370 0.84
371 0.83
372 0.81
373 0.81
374 0.81
375 0.81