Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166R9M7

Protein Details
Accession A0A166R9M7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
212-241ISSCVWCCVRKCRRKRREKKATMAAERNLPHydrophilic
NLS Segment(s)
PositionSequence
224-231RRKRREKK
Subcellular Location(s) mito 9extr 9, plas 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASSLTTSANATATSLLSIITPWVQPPDCETQWSTTTVSWTIESTATFQPIAVSNPAASCNPSGWDRFGPQSRLSFSPGVCPTGWEYHGMAEAGSPAASTALCCQRFFGLRNCVLQSWLTGFDSAASATTSQYTVMMHEAWAVTWAASDTATLTPKLPTLTSSMVVPVWTLGQKIREGEYDPVRPPSSSEYLSHGALFFLMIGMPIIGALMISSCVWCCVRKCRRKRREKKATMAAERNLPVDNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.07
5 0.07
6 0.08
7 0.09
8 0.09
9 0.09
10 0.15
11 0.16
12 0.16
13 0.21
14 0.28
15 0.27
16 0.3
17 0.31
18 0.3
19 0.31
20 0.33
21 0.3
22 0.23
23 0.24
24 0.22
25 0.22
26 0.18
27 0.17
28 0.16
29 0.15
30 0.15
31 0.16
32 0.16
33 0.16
34 0.15
35 0.14
36 0.14
37 0.15
38 0.16
39 0.14
40 0.13
41 0.12
42 0.13
43 0.15
44 0.14
45 0.13
46 0.12
47 0.11
48 0.13
49 0.15
50 0.16
51 0.17
52 0.19
53 0.2
54 0.25
55 0.29
56 0.3
57 0.31
58 0.33
59 0.34
60 0.33
61 0.35
62 0.31
63 0.26
64 0.31
65 0.29
66 0.28
67 0.24
68 0.23
69 0.22
70 0.23
71 0.23
72 0.17
73 0.16
74 0.14
75 0.16
76 0.14
77 0.11
78 0.08
79 0.08
80 0.06
81 0.05
82 0.04
83 0.03
84 0.04
85 0.04
86 0.04
87 0.07
88 0.14
89 0.15
90 0.15
91 0.16
92 0.18
93 0.2
94 0.23
95 0.26
96 0.25
97 0.27
98 0.29
99 0.29
100 0.28
101 0.26
102 0.24
103 0.18
104 0.13
105 0.12
106 0.1
107 0.09
108 0.08
109 0.08
110 0.08
111 0.07
112 0.06
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.07
129 0.06
130 0.05
131 0.05
132 0.05
133 0.04
134 0.04
135 0.04
136 0.05
137 0.07
138 0.08
139 0.08
140 0.09
141 0.09
142 0.1
143 0.11
144 0.1
145 0.09
146 0.12
147 0.14
148 0.14
149 0.13
150 0.13
151 0.13
152 0.12
153 0.11
154 0.08
155 0.07
156 0.07
157 0.08
158 0.08
159 0.11
160 0.12
161 0.14
162 0.15
163 0.15
164 0.18
165 0.23
166 0.27
167 0.29
168 0.3
169 0.33
170 0.32
171 0.31
172 0.29
173 0.3
174 0.29
175 0.26
176 0.26
177 0.27
178 0.28
179 0.29
180 0.28
181 0.22
182 0.17
183 0.15
184 0.13
185 0.07
186 0.05
187 0.04
188 0.04
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.02
196 0.02
197 0.02
198 0.03
199 0.04
200 0.04
201 0.05
202 0.08
203 0.09
204 0.13
205 0.17
206 0.27
207 0.38
208 0.48
209 0.59
210 0.68
211 0.78
212 0.86
213 0.94
214 0.94
215 0.95
216 0.95
217 0.95
218 0.94
219 0.93
220 0.92
221 0.89
222 0.81
223 0.77
224 0.68
225 0.59