Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166R9M7

Protein Details
Accession A0A166R9M7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
212-241ISSCVWCCVRKCRRKRREKKATMAAERNLPHydrophilic
NLS Segment(s)
PositionSequence
224-231RRKRREKK
Subcellular Location(s) mito 9, extr 9, plas 7
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASSLTTSANATATSLLSIITPWVQPPDCETQWSTTTVSWTIESTATFQPIAVSNPAASCNPSGWDRFGPQSRLSFSPGVCPTGWEYHGMAEAGSPAASTALCCQRFFGLRNCVLQSWLTGFDSAASATTSQYTVMMHEAWAVTWAASDTATLTPKLPTLTSSMVVPVWTLGQKIREGEYDPVRPPSSSEYLSHGALFFLMIGMPIIGALMISSCVWCCVRKCRRKRREKKATMAAERNLPVDNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.07
5 0.07
6 0.08
7 0.09
8 0.09
9 0.09
10 0.15
11 0.16
12 0.16
13 0.21
14 0.28
15 0.27
16 0.3
17 0.31
18 0.3
19 0.31
20 0.33
21 0.3
22 0.23
23 0.24
24 0.22
25 0.22
26 0.18
27 0.17
28 0.16
29 0.15
30 0.15
31 0.16
32 0.16
33 0.16
34 0.15
35 0.14
36 0.14
37 0.15
38 0.16
39 0.14
40 0.13
41 0.12
42 0.13
43 0.15
44 0.14
45 0.13
46 0.12
47 0.11
48 0.13
49 0.15
50 0.16
51 0.17
52 0.19
53 0.2
54 0.25
55 0.29
56 0.3
57 0.31
58 0.33
59 0.34
60 0.33
61 0.35
62 0.31
63 0.26
64 0.31
65 0.29
66 0.28
67 0.24
68 0.23
69 0.22
70 0.23
71 0.23
72 0.17
73 0.16
74 0.14
75 0.16
76 0.14
77 0.11
78 0.08
79 0.08
80 0.06
81 0.05
82 0.04
83 0.03
84 0.04
85 0.04
86 0.04
87 0.07
88 0.14
89 0.15
90 0.15
91 0.16
92 0.18
93 0.2
94 0.23
95 0.26
96 0.25
97 0.27
98 0.29
99 0.29
100 0.28
101 0.26
102 0.24
103 0.18
104 0.13
105 0.12
106 0.1
107 0.09
108 0.08
109 0.08
110 0.08
111 0.07
112 0.06
113 0.05
114 0.05
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.05
122 0.06
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.07
129 0.06
130 0.05
131 0.05
132 0.05
133 0.04
134 0.04
135 0.04
136 0.05
137 0.07
138 0.08
139 0.08
140 0.09
141 0.09
142 0.1
143 0.11
144 0.1
145 0.09
146 0.12
147 0.14
148 0.14
149 0.13
150 0.13
151 0.13
152 0.12
153 0.11
154 0.08
155 0.07
156 0.07
157 0.08
158 0.08
159 0.11
160 0.12
161 0.14
162 0.15
163 0.15
164 0.18
165 0.23
166 0.27
167 0.29
168 0.3
169 0.33
170 0.32
171 0.31
172 0.29
173 0.3
174 0.29
175 0.26
176 0.26
177 0.27
178 0.28
179 0.29
180 0.28
181 0.22
182 0.17
183 0.15
184 0.13
185 0.07
186 0.05
187 0.04
188 0.04
189 0.04
190 0.03
191 0.03
192 0.03
193 0.03
194 0.03
195 0.02
196 0.02
197 0.02
198 0.03
199 0.04
200 0.04
201 0.05
202 0.08
203 0.09
204 0.13
205 0.17
206 0.27
207 0.38
208 0.48
209 0.59
210 0.68
211 0.78
212 0.86
213 0.94
214 0.94
215 0.95
216 0.95
217 0.95
218 0.94
219 0.93
220 0.92
221 0.89
222 0.81
223 0.77
224 0.68
225 0.59