Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A161W969

Protein Details
Accession A0A161W969    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
11-37GPPPHIRWSRKPTTRCHRSRRDEQAVTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, nucl 2
Family & Domain DBs
Amino Acid Sequences MSWVWLAKTAGPPPHIRWSRKPTTRCHRSRRDEQAVTPGMTSSCMRNPRQVCLQPFHQEVRSGMVAVGLPRGAEEETLPAATP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.52
4 0.56
5 0.6
6 0.67
7 0.72
8 0.72
9 0.72
10 0.75
11 0.8
12 0.8
13 0.81
14 0.82
15 0.81
16 0.86
17 0.86
18 0.84
19 0.76
20 0.68
21 0.66
22 0.57
23 0.49
24 0.39
25 0.29
26 0.19
27 0.18
28 0.17
29 0.11
30 0.13
31 0.18
32 0.19
33 0.27
34 0.28
35 0.31
36 0.38
37 0.43
38 0.41
39 0.4
40 0.44
41 0.42
42 0.44
43 0.43
44 0.37
45 0.33
46 0.3
47 0.3
48 0.26
49 0.21
50 0.17
51 0.15
52 0.14
53 0.13
54 0.13
55 0.08
56 0.07
57 0.07
58 0.09
59 0.08
60 0.08
61 0.08
62 0.1
63 0.12