Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166NIA7

Protein Details
Accession A0A166NIA7   
Localization Confidence Medium
Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
54-103ETWPKNWCRRTPDRPRRPSRYLHPGHRGYRRRPARNRKPQRHNSALRPVPBasic
NLS Segment(s)
PositionSequence
65-101PDRPRRPSRYLHPGHRGYRRRPARNRKPQRHNSALRP
Subcellular Location(s) mito 15, nucl 6, cyto 5
Family & Domain DBs
Amino Acid Sequences MPRRFQLARVELPRGEFMSNGTYGAGGVGNYESISPIIGAKYDDRTGESQYVPETWPKNWCRRTPDRPRRPSRYLHPGHRGYRRRPARNRKPQRHNSALRPVPGHELRRAPLFSPPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.32
3 0.23
4 0.2
5 0.19
6 0.18
7 0.16
8 0.13
9 0.11
10 0.1
11 0.1
12 0.09
13 0.05
14 0.05
15 0.05
16 0.05
17 0.05
18 0.05
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.07
27 0.08
28 0.11
29 0.12
30 0.12
31 0.13
32 0.15
33 0.17
34 0.18
35 0.17
36 0.15
37 0.14
38 0.15
39 0.13
40 0.16
41 0.15
42 0.14
43 0.22
44 0.25
45 0.33
46 0.38
47 0.42
48 0.46
49 0.54
50 0.63
51 0.67
52 0.74
53 0.76
54 0.81
55 0.86
56 0.86
57 0.82
58 0.78
59 0.75
60 0.74
61 0.71
62 0.69
63 0.68
64 0.67
65 0.7
66 0.73
67 0.72
68 0.67
69 0.71
70 0.72
71 0.74
72 0.77
73 0.82
74 0.83
75 0.87
76 0.93
77 0.93
78 0.94
79 0.94
80 0.93
81 0.92
82 0.89
83 0.86
84 0.86
85 0.8
86 0.73
87 0.65
88 0.56
89 0.54
90 0.53
91 0.49
92 0.44
93 0.43
94 0.42
95 0.46
96 0.46
97 0.38