Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166RGK0

Protein Details
Accession A0A166RGK0    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
86-109DAPAPKAKTPRKKATPKKKTAAAEHydrophilic
141-164NADDTPKKRRSPTKKTAPKAEPESHydrophilic
NLS Segment(s)
PositionSequence
90-104PKAKTPRKKATPKKK
134-137KKRA
145-159TPKKRRSPTKKTAPK
Subcellular Location(s) nucl 20, mito 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MADAKGSASVSPNAAEGAPAGGRVGAWTDTERFQLVLRVLATQLSDGKGVDWKRISMPNRTLKAMQGQWTSIVAQMRELNTDDGGDAPAPKAKTPRKKATPKKKTAAAENSENANEDTGDDRDNEVTKKTGTPKKRAAATNADDTPKKRRSPTKKTAPKAEPESEAGDEDTVPKEENDDEQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.09
4 0.1
5 0.09
6 0.08
7 0.08
8 0.07
9 0.07
10 0.07
11 0.09
12 0.07
13 0.09
14 0.11
15 0.13
16 0.14
17 0.16
18 0.16
19 0.15
20 0.14
21 0.17
22 0.16
23 0.17
24 0.16
25 0.15
26 0.15
27 0.15
28 0.15
29 0.12
30 0.12
31 0.1
32 0.1
33 0.09
34 0.1
35 0.14
36 0.15
37 0.19
38 0.18
39 0.18
40 0.21
41 0.29
42 0.31
43 0.34
44 0.42
45 0.46
46 0.47
47 0.49
48 0.46
49 0.4
50 0.44
51 0.39
52 0.36
53 0.28
54 0.26
55 0.24
56 0.24
57 0.22
58 0.18
59 0.16
60 0.11
61 0.11
62 0.13
63 0.12
64 0.13
65 0.14
66 0.12
67 0.11
68 0.11
69 0.09
70 0.07
71 0.07
72 0.06
73 0.05
74 0.05
75 0.08
76 0.08
77 0.08
78 0.16
79 0.23
80 0.33
81 0.41
82 0.5
83 0.58
84 0.68
85 0.78
86 0.83
87 0.86
88 0.85
89 0.83
90 0.8
91 0.74
92 0.71
93 0.69
94 0.62
95 0.56
96 0.49
97 0.44
98 0.37
99 0.35
100 0.27
101 0.19
102 0.14
103 0.1
104 0.1
105 0.09
106 0.09
107 0.09
108 0.1
109 0.11
110 0.13
111 0.13
112 0.12
113 0.13
114 0.14
115 0.17
116 0.25
117 0.32
118 0.38
119 0.46
120 0.53
121 0.58
122 0.64
123 0.63
124 0.6
125 0.61
126 0.58
127 0.58
128 0.53
129 0.5
130 0.45
131 0.44
132 0.47
133 0.45
134 0.45
135 0.46
136 0.53
137 0.6
138 0.69
139 0.77
140 0.79
141 0.83
142 0.86
143 0.89
144 0.84
145 0.83
146 0.8
147 0.74
148 0.66
149 0.58
150 0.54
151 0.45
152 0.4
153 0.32
154 0.24
155 0.2
156 0.18
157 0.17
158 0.14
159 0.14
160 0.12
161 0.14