Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166Y6N5

Protein Details
Accession A0A166Y6N5   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
488-507TATPVLRAKRHLHQHRKHHLBasic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR018535  DUF1996  
Pfam View protein in Pfam  
PF09362  DUF1996  
Amino Acid Sequences MKYSTSSVIATVGFFAAGADAFWRMECPSRVGLTRVDPLMSFGGAAPHVHAIHGSSGISPTATFSDLVDADCTSCRVKQDKSAYWHPALYFQDSSTGQFELVDQVGGMLAYYLLNGKDIKAFPPGFRMIAGDTDRRTYTAGDPSKPDPQKSSWSLLGQTKQSILQQRAIGFNCLNYGRDPEGTLYRHFLPDKAFLDANCANGVRFEMMFPSCWNGKDVDSKDHKSHVAYPDLVIDGTCPDGFETSVPNLLYEVIWNTNAFKNRNGRFVIANGDTQGYGYHADFISGWDEDFLQSAVDTCTNLSGRIEDCPIFDLQDEAATAQCEMKIPDIVAKDNVNGPDSILPGNVAITFGDGSSEGGAAPVSSSTIAAPTVPTLTYKPGKTATANPLPGEVFHETGKIPYGSSISVEAVSTPVPEPAAPTTEPTPTPIIEPVITSAPASSSQQSISFVSTQTITSGNTVSIIYWEEEIVYVTEYEDITATLTVTPTATPVLRAKRHLHQHRKHHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.06
4 0.06
5 0.05
6 0.05
7 0.06
8 0.07
9 0.07
10 0.08
11 0.1
12 0.16
13 0.18
14 0.21
15 0.24
16 0.28
17 0.3
18 0.32
19 0.34
20 0.33
21 0.36
22 0.33
23 0.3
24 0.26
25 0.27
26 0.26
27 0.21
28 0.17
29 0.12
30 0.13
31 0.13
32 0.13
33 0.12
34 0.14
35 0.14
36 0.13
37 0.13
38 0.12
39 0.13
40 0.14
41 0.13
42 0.1
43 0.11
44 0.11
45 0.11
46 0.09
47 0.1
48 0.1
49 0.11
50 0.1
51 0.1
52 0.14
53 0.14
54 0.15
55 0.14
56 0.13
57 0.13
58 0.13
59 0.15
60 0.13
61 0.14
62 0.19
63 0.23
64 0.26
65 0.34
66 0.43
67 0.49
68 0.55
69 0.62
70 0.63
71 0.6
72 0.6
73 0.51
74 0.49
75 0.43
76 0.4
77 0.32
78 0.26
79 0.29
80 0.26
81 0.28
82 0.23
83 0.21
84 0.16
85 0.15
86 0.15
87 0.13
88 0.12
89 0.1
90 0.08
91 0.07
92 0.07
93 0.07
94 0.06
95 0.03
96 0.03
97 0.03
98 0.03
99 0.05
100 0.05
101 0.07
102 0.07
103 0.08
104 0.13
105 0.14
106 0.15
107 0.22
108 0.23
109 0.22
110 0.28
111 0.29
112 0.24
113 0.24
114 0.24
115 0.17
116 0.21
117 0.23
118 0.21
119 0.2
120 0.23
121 0.23
122 0.22
123 0.22
124 0.19
125 0.2
126 0.26
127 0.29
128 0.29
129 0.32
130 0.35
131 0.43
132 0.44
133 0.42
134 0.36
135 0.35
136 0.41
137 0.42
138 0.43
139 0.37
140 0.37
141 0.39
142 0.4
143 0.4
144 0.34
145 0.31
146 0.27
147 0.25
148 0.27
149 0.3
150 0.27
151 0.28
152 0.29
153 0.29
154 0.33
155 0.33
156 0.31
157 0.24
158 0.22
159 0.2
160 0.18
161 0.18
162 0.13
163 0.16
164 0.15
165 0.15
166 0.16
167 0.15
168 0.19
169 0.2
170 0.2
171 0.2
172 0.2
173 0.23
174 0.22
175 0.22
176 0.2
177 0.24
178 0.24
179 0.24
180 0.23
181 0.2
182 0.26
183 0.25
184 0.23
185 0.18
186 0.17
187 0.14
188 0.14
189 0.14
190 0.08
191 0.08
192 0.07
193 0.08
194 0.08
195 0.09
196 0.09
197 0.12
198 0.12
199 0.12
200 0.13
201 0.12
202 0.14
203 0.21
204 0.23
205 0.28
206 0.33
207 0.36
208 0.36
209 0.38
210 0.37
211 0.31
212 0.35
213 0.3
214 0.27
215 0.24
216 0.23
217 0.21
218 0.21
219 0.19
220 0.13
221 0.09
222 0.06
223 0.06
224 0.06
225 0.05
226 0.04
227 0.05
228 0.05
229 0.05
230 0.07
231 0.06
232 0.09
233 0.09
234 0.09
235 0.08
236 0.09
237 0.08
238 0.07
239 0.07
240 0.06
241 0.06
242 0.06
243 0.08
244 0.11
245 0.15
246 0.16
247 0.19
248 0.27
249 0.29
250 0.34
251 0.34
252 0.32
253 0.29
254 0.29
255 0.3
256 0.22
257 0.21
258 0.16
259 0.15
260 0.13
261 0.12
262 0.11
263 0.07
264 0.07
265 0.06
266 0.07
267 0.07
268 0.07
269 0.07
270 0.08
271 0.09
272 0.08
273 0.08
274 0.06
275 0.06
276 0.06
277 0.07
278 0.06
279 0.04
280 0.04
281 0.05
282 0.05
283 0.05
284 0.05
285 0.05
286 0.07
287 0.08
288 0.08
289 0.08
290 0.09
291 0.09
292 0.1
293 0.12
294 0.1
295 0.11
296 0.12
297 0.12
298 0.11
299 0.1
300 0.09
301 0.07
302 0.08
303 0.07
304 0.06
305 0.06
306 0.06
307 0.06
308 0.06
309 0.06
310 0.06
311 0.07
312 0.08
313 0.08
314 0.08
315 0.12
316 0.13
317 0.14
318 0.15
319 0.15
320 0.15
321 0.17
322 0.18
323 0.16
324 0.14
325 0.14
326 0.13
327 0.14
328 0.13
329 0.1
330 0.09
331 0.08
332 0.08
333 0.08
334 0.06
335 0.05
336 0.05
337 0.05
338 0.05
339 0.05
340 0.05
341 0.05
342 0.05
343 0.06
344 0.05
345 0.05
346 0.05
347 0.04
348 0.04
349 0.04
350 0.04
351 0.04
352 0.04
353 0.04
354 0.05
355 0.06
356 0.06
357 0.06
358 0.06
359 0.07
360 0.07
361 0.09
362 0.09
363 0.15
364 0.21
365 0.21
366 0.24
367 0.25
368 0.28
369 0.3
370 0.36
371 0.38
372 0.41
373 0.43
374 0.39
375 0.39
376 0.36
377 0.33
378 0.3
379 0.23
380 0.17
381 0.15
382 0.16
383 0.15
384 0.15
385 0.18
386 0.13
387 0.12
388 0.11
389 0.13
390 0.12
391 0.12
392 0.13
393 0.11
394 0.12
395 0.11
396 0.1
397 0.1
398 0.09
399 0.1
400 0.08
401 0.08
402 0.08
403 0.08
404 0.11
405 0.12
406 0.15
407 0.14
408 0.17
409 0.19
410 0.22
411 0.22
412 0.23
413 0.23
414 0.2
415 0.22
416 0.21
417 0.21
418 0.18
419 0.18
420 0.17
421 0.17
422 0.17
423 0.15
424 0.13
425 0.12
426 0.13
427 0.15
428 0.14
429 0.14
430 0.15
431 0.16
432 0.19
433 0.18
434 0.2
435 0.18
436 0.17
437 0.17
438 0.17
439 0.16
440 0.15
441 0.15
442 0.13
443 0.13
444 0.14
445 0.12
446 0.12
447 0.12
448 0.11
449 0.1
450 0.12
451 0.11
452 0.11
453 0.1
454 0.1
455 0.1
456 0.11
457 0.1
458 0.09
459 0.08
460 0.08
461 0.1
462 0.09
463 0.09
464 0.09
465 0.08
466 0.08
467 0.08
468 0.09
469 0.08
470 0.09
471 0.09
472 0.09
473 0.09
474 0.09
475 0.12
476 0.11
477 0.15
478 0.22
479 0.31
480 0.36
481 0.42
482 0.47
483 0.54
484 0.65
485 0.72
486 0.76
487 0.76