Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166Z5R4

Protein Details
Accession A0A166Z5R4    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
313-333ALDRHVPKHGHDRPRKSSCIMBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 9.833, nucl 8.5, mito 8, cyto 8, cyto_pero 5.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR006710  Glyco_hydro_43  
IPR023296  Glyco_hydro_beta-prop_sf  
Gene Ontology GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF04616  Glyco_hydro_43  
CDD cd18820  GH43_LbAraf43-like  
Amino Acid Sequences MSNRTICDVDTPDPWIMAGNGKFYLTFTLDNRIEIWSSNTLENFHHCHKSVVWQPAPGTPWSVNIWAPELHYLNGRWYIYTCGAPPGVGNPGHRTTVLRSSSHDPMDAGAWEFLGPLKGMPDHWSIDATVFSPNGHDLYCCWSGWPIGDTSDTQQDLFLIKLRVPEEAITETLVCISRAELPWERPDGGRRGVNEGPTWVNIPGAFRGIVYSADGSWTSDYKLGLLPLVGQDPLNPTSWAKRSTPLLVSHERCGGPYGPGHASFLPNPHDRSRVYCIYHATAKYGEGWANRKARVIDLGPECFGLHAHSVCCALDRHVPKHGHDRPRKSSCIMS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.16
4 0.2
5 0.2
6 0.18
7 0.19
8 0.19
9 0.19
10 0.18
11 0.21
12 0.17
13 0.19
14 0.18
15 0.26
16 0.26
17 0.27
18 0.27
19 0.26
20 0.24
21 0.21
22 0.24
23 0.19
24 0.21
25 0.23
26 0.22
27 0.22
28 0.23
29 0.27
30 0.28
31 0.29
32 0.32
33 0.3
34 0.32
35 0.31
36 0.38
37 0.42
38 0.46
39 0.43
40 0.41
41 0.41
42 0.43
43 0.44
44 0.36
45 0.33
46 0.23
47 0.24
48 0.23
49 0.24
50 0.21
51 0.19
52 0.21
53 0.18
54 0.18
55 0.19
56 0.18
57 0.17
58 0.19
59 0.18
60 0.19
61 0.23
62 0.22
63 0.18
64 0.18
65 0.21
66 0.21
67 0.22
68 0.19
69 0.17
70 0.17
71 0.16
72 0.15
73 0.13
74 0.15
75 0.16
76 0.17
77 0.19
78 0.22
79 0.23
80 0.23
81 0.23
82 0.22
83 0.29
84 0.31
85 0.26
86 0.28
87 0.32
88 0.37
89 0.36
90 0.32
91 0.24
92 0.21
93 0.21
94 0.18
95 0.14
96 0.09
97 0.08
98 0.07
99 0.07
100 0.07
101 0.06
102 0.06
103 0.04
104 0.06
105 0.06
106 0.07
107 0.1
108 0.12
109 0.13
110 0.13
111 0.14
112 0.13
113 0.13
114 0.13
115 0.11
116 0.09
117 0.08
118 0.07
119 0.07
120 0.08
121 0.08
122 0.07
123 0.07
124 0.06
125 0.12
126 0.14
127 0.13
128 0.12
129 0.12
130 0.12
131 0.13
132 0.13
133 0.08
134 0.07
135 0.09
136 0.09
137 0.1
138 0.13
139 0.13
140 0.12
141 0.11
142 0.11
143 0.1
144 0.1
145 0.11
146 0.08
147 0.09
148 0.12
149 0.12
150 0.12
151 0.12
152 0.12
153 0.11
154 0.12
155 0.11
156 0.09
157 0.08
158 0.08
159 0.08
160 0.08
161 0.06
162 0.05
163 0.06
164 0.08
165 0.09
166 0.13
167 0.14
168 0.16
169 0.19
170 0.21
171 0.21
172 0.19
173 0.22
174 0.22
175 0.23
176 0.24
177 0.22
178 0.26
179 0.27
180 0.27
181 0.24
182 0.22
183 0.2
184 0.18
185 0.19
186 0.12
187 0.11
188 0.1
189 0.11
190 0.09
191 0.09
192 0.09
193 0.07
194 0.08
195 0.08
196 0.08
197 0.07
198 0.07
199 0.06
200 0.07
201 0.07
202 0.08
203 0.08
204 0.08
205 0.08
206 0.1
207 0.1
208 0.1
209 0.11
210 0.1
211 0.09
212 0.09
213 0.08
214 0.08
215 0.09
216 0.08
217 0.07
218 0.07
219 0.11
220 0.12
221 0.13
222 0.13
223 0.13
224 0.19
225 0.23
226 0.26
227 0.24
228 0.26
229 0.28
230 0.32
231 0.36
232 0.35
233 0.37
234 0.42
235 0.44
236 0.42
237 0.44
238 0.39
239 0.35
240 0.33
241 0.28
242 0.21
243 0.2
244 0.22
245 0.19
246 0.2
247 0.22
248 0.2
249 0.22
250 0.21
251 0.23
252 0.25
253 0.26
254 0.3
255 0.31
256 0.34
257 0.32
258 0.37
259 0.41
260 0.42
261 0.41
262 0.4
263 0.41
264 0.42
265 0.47
266 0.41
267 0.37
268 0.31
269 0.28
270 0.26
271 0.24
272 0.23
273 0.22
274 0.25
275 0.3
276 0.35
277 0.35
278 0.37
279 0.36
280 0.35
281 0.37
282 0.35
283 0.35
284 0.35
285 0.37
286 0.33
287 0.33
288 0.31
289 0.25
290 0.23
291 0.17
292 0.15
293 0.14
294 0.14
295 0.15
296 0.16
297 0.16
298 0.18
299 0.16
300 0.16
301 0.23
302 0.29
303 0.32
304 0.39
305 0.42
306 0.45
307 0.55
308 0.61
309 0.63
310 0.67
311 0.73
312 0.75
313 0.8
314 0.81