Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WQ43

Protein Details
Accession G2WQ43   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
6-31DDGGAVKKALRQKRKVRFEDQVKDDTHydrophilic
NLS Segment(s)
PositionSequence
12-20KKALRQKRK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, cyto 4.5, pero 4, mito 3
Family & Domain DBs
KEGG vda:VDAG_00485  -  
Amino Acid Sequences MTGRKDDGGAVKKALRQKRKVRFEDQVKDDTPRSDSKRRKSSSSSRQNPSPLSKPDQLAASPPPEPPADLTPAEQRRQAEQERRDTANEQKSPVLPTPRAIREAHIKKEYAPDDRATAELAAGMLNLVSLAARMSAFPPGDAGRYGALGYIIKRLDRLDLDGVDARVTDMTPAQAAAAERDVQARLREGQAQQRKLFNMKNTKKYAAGLRRFVADPPAYRREVAARCARIFIHDSYARAFVKWLRQLDRAARLECRYFHAVNWEPRKVTDGETEVWVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.55
3 0.59
4 0.67
5 0.74
6 0.81
7 0.84
8 0.84
9 0.85
10 0.85
11 0.85
12 0.8
13 0.76
14 0.68
15 0.64
16 0.58
17 0.5
18 0.44
19 0.42
20 0.44
21 0.47
22 0.54
23 0.6
24 0.68
25 0.7
26 0.73
27 0.74
28 0.77
29 0.78
30 0.8
31 0.79
32 0.75
33 0.77
34 0.76
35 0.72
36 0.68
37 0.65
38 0.6
39 0.57
40 0.55
41 0.51
42 0.47
43 0.44
44 0.37
45 0.33
46 0.3
47 0.26
48 0.23
49 0.22
50 0.22
51 0.2
52 0.2
53 0.19
54 0.18
55 0.19
56 0.19
57 0.2
58 0.27
59 0.32
60 0.33
61 0.33
62 0.32
63 0.32
64 0.37
65 0.43
66 0.43
67 0.45
68 0.52
69 0.54
70 0.55
71 0.53
72 0.5
73 0.51
74 0.51
75 0.46
76 0.39
77 0.36
78 0.35
79 0.36
80 0.37
81 0.35
82 0.26
83 0.27
84 0.32
85 0.33
86 0.35
87 0.32
88 0.3
89 0.35
90 0.41
91 0.44
92 0.4
93 0.38
94 0.36
95 0.43
96 0.43
97 0.37
98 0.33
99 0.27
100 0.26
101 0.26
102 0.25
103 0.18
104 0.15
105 0.1
106 0.08
107 0.07
108 0.05
109 0.04
110 0.04
111 0.03
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.03
120 0.03
121 0.04
122 0.07
123 0.07
124 0.06
125 0.08
126 0.08
127 0.08
128 0.08
129 0.09
130 0.06
131 0.07
132 0.07
133 0.06
134 0.06
135 0.06
136 0.06
137 0.09
138 0.09
139 0.09
140 0.1
141 0.1
142 0.12
143 0.12
144 0.14
145 0.12
146 0.12
147 0.14
148 0.15
149 0.14
150 0.12
151 0.12
152 0.09
153 0.07
154 0.07
155 0.06
156 0.05
157 0.05
158 0.05
159 0.05
160 0.05
161 0.06
162 0.06
163 0.07
164 0.07
165 0.08
166 0.08
167 0.09
168 0.1
169 0.11
170 0.11
171 0.12
172 0.13
173 0.14
174 0.18
175 0.19
176 0.29
177 0.36
178 0.41
179 0.42
180 0.44
181 0.44
182 0.46
183 0.47
184 0.46
185 0.49
186 0.51
187 0.57
188 0.59
189 0.59
190 0.55
191 0.54
192 0.56
193 0.54
194 0.53
195 0.49
196 0.45
197 0.46
198 0.45
199 0.42
200 0.39
201 0.32
202 0.29
203 0.31
204 0.36
205 0.34
206 0.33
207 0.34
208 0.35
209 0.35
210 0.38
211 0.4
212 0.4
213 0.39
214 0.41
215 0.4
216 0.35
217 0.36
218 0.3
219 0.3
220 0.27
221 0.28
222 0.28
223 0.33
224 0.3
225 0.27
226 0.27
227 0.23
228 0.29
229 0.35
230 0.39
231 0.39
232 0.42
233 0.48
234 0.53
235 0.58
236 0.55
237 0.51
238 0.5
239 0.49
240 0.5
241 0.46
242 0.45
243 0.41
244 0.37
245 0.35
246 0.39
247 0.43
248 0.49
249 0.55
250 0.54
251 0.49
252 0.49
253 0.52
254 0.44
255 0.4
256 0.38
257 0.33
258 0.3