FuNGI

G2XC91

Protein Details

Accession

G2XC91

Localization Confidence

Low

Confidence Score

NoLS Segment(s)

Position	Sequence	Protein Nature
12-34	LLEVKGLRRKRHTPTTRRSMDEP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

plas 26

Family & Domain DBs

InterPro	View protein in InterPro IPR011701 MFS IPR020846 MFS_dom IPR036259 MFS_trans_sf
Gene Ontology	GO:0000329 C:fungal-type vacuole membrane GO:0005886 C:plasma membrane GO:0015606 F:spermidine transmembrane transporter activity GO:0000297 F:spermine transmembrane transporter activity
KEGG	vda:VDAG_07773 -
Pfam	View protein in Pfam PF07690 MFS_1
PROSITE	View protein in PROSITE PS50850 MFS
CDD	cd17323 MFS_Tpo1_MDR_like

Amino Acid Sequences

MARPQLYTQIDLLEVKGLRRKRHTPTTRRSMDEPNNTEKDVASPPPETWEQDSQNPLNWPSREKFKNTFIASISAFTASVGTSLPSSATYQYQEEFGVNVMQSILPLSMYVFALGLGPVLGGPLSETVGRHPIYAGSMFFGALFTVGAGLTHNFGALCFLRFMAGFSFSPSLAVGAGTISDMFHPAQRGLPSTLFILMPFLGPGFGPVIGSFVVVRKGWRWTQWTLVFFATASLLVSLAGKETYRPILERRRAKRLGHPTGDKTPLGSHILMFLRIALVRPLHMLFTEPIITFVALYVACEFATLFAFFAGVPYVFRRVHGFSIEQSGLVFISIVIGCLLGAVTIIVLTVVSYLPRAKQLHPERVPPEYRLIPAMFGSIGLPISLFMFGWTARDDISWAVPAFAIIIFAWGNLCIFVSTIQYTVDTYTGANVASGASANGFARYTLAGVLPLFTVQMYRSLGIPWAASLLAFVSLALAPVPWVLFKWGHIIRKKSRYETA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.2
2	0.21
3	0.27
4	0.31
5	0.37
6	0.45
7	0.53
8	0.57
9	0.67
10	0.75
11	0.79
12	0.84
13	0.87
14	0.86
15	0.83
16	0.78
17	0.78
18	0.77
19	0.76
20	0.71
21	0.69
22	0.65
23	0.6
24	0.56
25	0.46
26	0.4
27	0.34
28	0.32
29	0.27
30	0.25
31	0.25
32	0.3
33	0.32
34	0.31
35	0.32
36	0.36
37	0.36
38	0.39
39	0.46
40	0.42
41	0.44
42	0.44
43	0.42
44	0.42
45	0.4
46	0.4
47	0.38
48	0.47
49	0.47
50	0.51
51	0.54
52	0.54
53	0.62
54	0.59
55	0.58
56	0.5
57	0.48
58	0.42
59	0.37
60	0.3
61	0.21
62	0.18
63	0.14
64	0.13
65	0.08
66	0.08
67	0.07
68	0.06
69	0.06
70	0.06
71	0.07
72	0.07
73	0.09
74	0.1
75	0.13
76	0.14
77	0.16
78	0.16
79	0.17
80	0.17
81	0.15
82	0.14
83	0.12
84	0.12
85	0.1
86	0.1
87	0.09
88	0.08
89	0.08
90	0.08
91	0.07
92	0.05
93	0.05
94	0.05
95	0.06
96	0.07
97	0.07
98	0.06
99	0.06
100	0.06
101	0.06
102	0.06
103	0.04
104	0.04
105	0.03
106	0.03
107	0.03
108	0.03
109	0.03
110	0.04
111	0.05
112	0.06
113	0.06
114	0.08
115	0.14
116	0.15
117	0.14
118	0.14
119	0.14
120	0.15
121	0.16
122	0.15
123	0.1
124	0.1
125	0.1
126	0.09
127	0.09
128	0.07
129	0.05
130	0.05
131	0.03
132	0.04
133	0.03
134	0.03
135	0.04
136	0.04
137	0.05
138	0.05
139	0.06
140	0.05
141	0.05
142	0.08
143	0.08
144	0.09
145	0.08
146	0.09
147	0.09
148	0.09
149	0.1
150	0.08
151	0.11
152	0.1
153	0.12
154	0.13
155	0.12
156	0.13
157	0.12
158	0.11
159	0.07
160	0.07
161	0.05
162	0.04
163	0.04
164	0.04
165	0.04
166	0.04
167	0.04
168	0.05
169	0.06
170	0.07
171	0.08
172	0.08
173	0.11
174	0.12
175	0.15
176	0.15
177	0.16
178	0.15
179	0.15
180	0.15
181	0.13
182	0.12
183	0.1
184	0.08
185	0.07
186	0.06
187	0.06
188	0.05
189	0.04
190	0.05
191	0.05
192	0.04
193	0.05
194	0.04
195	0.06
196	0.05
197	0.06
198	0.05
199	0.06
200	0.08
201	0.08
202	0.09
203	0.09
204	0.13
205	0.15
206	0.19
207	0.23
208	0.22
209	0.3
210	0.34
211	0.33
212	0.31
213	0.29
214	0.26
215	0.21
216	0.19
217	0.12
218	0.07
219	0.06
220	0.04
221	0.04
222	0.04
223	0.04
224	0.04
225	0.04
226	0.04
227	0.04
228	0.04
229	0.06
230	0.07
231	0.08
232	0.09
233	0.14
234	0.23
235	0.31
236	0.4
237	0.44
238	0.52
239	0.56
240	0.57
241	0.61
242	0.62
243	0.63
244	0.6
245	0.59
246	0.54
247	0.54
248	0.55
249	0.46
250	0.36
251	0.28
252	0.24
253	0.23
254	0.18
255	0.13
256	0.14
257	0.15
258	0.14
259	0.13
260	0.11
261	0.09
262	0.09
263	0.09
264	0.06
265	0.06
266	0.06
267	0.08
268	0.08
269	0.08
270	0.08
271	0.09
272	0.08
273	0.09
274	0.11
275	0.09
276	0.1
277	0.1
278	0.1
279	0.08
280	0.08
281	0.08
282	0.05
283	0.06
284	0.05
285	0.05
286	0.05
287	0.05
288	0.05
289	0.04
290	0.06
291	0.06
292	0.05
293	0.05
294	0.05
295	0.05
296	0.05
297	0.05
298	0.04
299	0.05
300	0.06
301	0.11
302	0.11
303	0.12
304	0.15
305	0.17
306	0.18
307	0.2
308	0.2
309	0.16
310	0.22
311	0.21
312	0.18
313	0.16
314	0.14
315	0.12
316	0.1
317	0.09
318	0.03
319	0.05
320	0.05
321	0.05
322	0.05
323	0.05
324	0.05
325	0.04
326	0.05
327	0.02
328	0.03
329	0.02
330	0.02
331	0.02
332	0.02
333	0.02
334	0.02
335	0.02
336	0.03
337	0.03
338	0.03
339	0.05
340	0.06
341	0.07
342	0.14
343	0.17
344	0.18
345	0.29
346	0.37
347	0.47
348	0.49
349	0.56
350	0.52
351	0.57
352	0.58
353	0.49
354	0.47
355	0.39
356	0.36
357	0.32
358	0.29
359	0.23
360	0.21
361	0.2
362	0.13
363	0.11
364	0.1
365	0.08
366	0.07
367	0.06
368	0.06
369	0.05
370	0.06
371	0.06
372	0.05
373	0.05
374	0.06
375	0.06
376	0.08
377	0.08
378	0.08
379	0.08
380	0.08
381	0.09
382	0.09
383	0.11
384	0.12
385	0.11
386	0.11
387	0.11
388	0.11
389	0.11
390	0.09
391	0.09
392	0.05
393	0.07
394	0.06
395	0.06
396	0.07
397	0.06
398	0.06
399	0.06
400	0.06
401	0.05
402	0.05
403	0.06
404	0.08
405	0.09
406	0.1
407	0.1
408	0.1
409	0.11
410	0.11
411	0.11
412	0.09
413	0.08
414	0.09
415	0.09
416	0.09
417	0.08
418	0.07
419	0.07
420	0.06
421	0.07
422	0.05
423	0.05
424	0.07
425	0.07
426	0.08
427	0.08
428	0.08
429	0.09
430	0.09
431	0.09
432	0.09
433	0.09
434	0.09
435	0.09
436	0.1
437	0.09
438	0.09
439	0.08
440	0.07
441	0.08
442	0.07
443	0.12
444	0.13
445	0.13
446	0.14
447	0.15
448	0.17
449	0.17
450	0.17
451	0.12
452	0.12
453	0.11
454	0.1
455	0.09
456	0.08
457	0.07
458	0.07
459	0.06
460	0.07
461	0.07
462	0.07
463	0.07
464	0.06
465	0.06
466	0.07
467	0.07
468	0.06
469	0.07
470	0.11
471	0.12
472	0.13
473	0.22
474	0.27
475	0.36
476	0.43
477	0.52
478	0.58
479	0.67
480	0.74

G2XC91

3D AlphaFold-predicted Structure Viewer