Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G2X7S4

Protein Details
Accession G2X7S4    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
246-270ARVKLMKPPKTPKPQKTPKAPGSRPHydrophilic
575-599HTHPSSHPPVIKKRDKGRRGEEAVVBasic
NLS Segment(s)
PositionSequence
247-280RVKLMKPPKTPKPQKTPKAPGSRPPKSAGGAGSA
455-495KPPASANRSHKRKRDSATETEPPKIGEPEKAAPRPPPAKRT
586-592KKRDKGR
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR024610  ING_N_histone-binding  
Gene Ontology GO:0000785  C:chromatin  
KEGG vda:VDAG_06532  -  
CDD cd17017  ING_Yng1p  
Amino Acid Sequences MAAVDASAEAEDAVSPKDKTTMEQDMPQPPLSAINNPLNSLQMRADPDAQATVTDFLDFTEYLPSDMMRSLTLIGQLDSRYHDASLNVHNMTTTWGQLPKIPAETRPAPSQLRADISDGLNRTVSSRAFAHAEAMRMDENVNRHYNRVKLILSKLQTMFENYPTEDEQKSPVAVAKSPQLARAPKPTLRLANGEKARRQMIPRITVPGEVLAPYDNFEAYSSDSDESSDDEDVEIAPYKAGAASNARVKLMKPPKTPKPQKTPKAPGSRPPKSAGGAGSAIAPPATPLPPPKKPPENAVIGSADAPWLQLTAWELAKLRKRMKKNAQWTPSDTMISRELNDLGRGIDAYREAKRKAEEEGIAFDPAPSAIAAESENGYQQTPEGALSAAALQSDEVQLSNRGMKLNEAKKLKRESLAKQAAEEAEESARLFNETARMLMTPQQPQSNSQAKASSKPPASANRSHKRKRDSATETEPPKIGEPEKAAPRPPPAKRTKTETPVPLPHLRASLSTQPLTETPVLPPVLTPGGTAVTPHSTTPVPLPVPGQDATKRTVSPALSKENGAGAGTITTKIHHTHPSSHPPVIKKRDKGRRGEEAVVLRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.18
5 0.18
6 0.21
7 0.27
8 0.34
9 0.35
10 0.41
11 0.46
12 0.48
13 0.52
14 0.5
15 0.43
16 0.34
17 0.37
18 0.32
19 0.3
20 0.3
21 0.34
22 0.34
23 0.35
24 0.35
25 0.33
26 0.31
27 0.29
28 0.25
29 0.21
30 0.24
31 0.26
32 0.28
33 0.25
34 0.26
35 0.25
36 0.24
37 0.2
38 0.17
39 0.16
40 0.13
41 0.12
42 0.11
43 0.09
44 0.12
45 0.11
46 0.1
47 0.14
48 0.14
49 0.15
50 0.15
51 0.15
52 0.14
53 0.15
54 0.15
55 0.1
56 0.1
57 0.11
58 0.11
59 0.14
60 0.14
61 0.13
62 0.15
63 0.15
64 0.15
65 0.18
66 0.19
67 0.17
68 0.17
69 0.18
70 0.17
71 0.2
72 0.25
73 0.26
74 0.24
75 0.22
76 0.22
77 0.2
78 0.23
79 0.2
80 0.16
81 0.15
82 0.17
83 0.17
84 0.21
85 0.24
86 0.23
87 0.29
88 0.28
89 0.27
90 0.32
91 0.37
92 0.38
93 0.39
94 0.41
95 0.37
96 0.39
97 0.4
98 0.36
99 0.35
100 0.32
101 0.3
102 0.29
103 0.28
104 0.29
105 0.27
106 0.24
107 0.21
108 0.2
109 0.19
110 0.18
111 0.17
112 0.16
113 0.15
114 0.16
115 0.18
116 0.18
117 0.21
118 0.2
119 0.21
120 0.19
121 0.19
122 0.17
123 0.15
124 0.16
125 0.14
126 0.15
127 0.18
128 0.24
129 0.23
130 0.25
131 0.29
132 0.32
133 0.32
134 0.34
135 0.31
136 0.31
137 0.35
138 0.4
139 0.38
140 0.4
141 0.38
142 0.35
143 0.34
144 0.33
145 0.3
146 0.26
147 0.27
148 0.21
149 0.23
150 0.23
151 0.25
152 0.21
153 0.2
154 0.19
155 0.18
156 0.18
157 0.16
158 0.17
159 0.16
160 0.16
161 0.17
162 0.19
163 0.23
164 0.23
165 0.26
166 0.28
167 0.31
168 0.33
169 0.4
170 0.41
171 0.38
172 0.42
173 0.44
174 0.43
175 0.42
176 0.45
177 0.4
178 0.43
179 0.47
180 0.47
181 0.45
182 0.44
183 0.44
184 0.41
185 0.39
186 0.38
187 0.38
188 0.4
189 0.38
190 0.4
191 0.38
192 0.36
193 0.33
194 0.27
195 0.2
196 0.14
197 0.13
198 0.09
199 0.08
200 0.08
201 0.08
202 0.07
203 0.07
204 0.07
205 0.08
206 0.08
207 0.09
208 0.1
209 0.1
210 0.1
211 0.1
212 0.1
213 0.1
214 0.1
215 0.09
216 0.08
217 0.07
218 0.07
219 0.07
220 0.07
221 0.07
222 0.06
223 0.05
224 0.05
225 0.05
226 0.06
227 0.05
228 0.06
229 0.08
230 0.1
231 0.15
232 0.16
233 0.17
234 0.17
235 0.17
236 0.26
237 0.33
238 0.38
239 0.41
240 0.49
241 0.58
242 0.68
243 0.78
244 0.77
245 0.79
246 0.81
247 0.82
248 0.85
249 0.85
250 0.82
251 0.83
252 0.77
253 0.74
254 0.74
255 0.72
256 0.64
257 0.58
258 0.51
259 0.42
260 0.41
261 0.33
262 0.25
263 0.2
264 0.17
265 0.14
266 0.12
267 0.1
268 0.08
269 0.07
270 0.05
271 0.06
272 0.06
273 0.06
274 0.11
275 0.17
276 0.23
277 0.27
278 0.34
279 0.4
280 0.4
281 0.44
282 0.44
283 0.43
284 0.38
285 0.36
286 0.3
287 0.23
288 0.22
289 0.18
290 0.13
291 0.07
292 0.07
293 0.04
294 0.04
295 0.03
296 0.04
297 0.05
298 0.07
299 0.07
300 0.08
301 0.09
302 0.13
303 0.19
304 0.24
305 0.31
306 0.36
307 0.42
308 0.51
309 0.61
310 0.66
311 0.71
312 0.75
313 0.73
314 0.7
315 0.69
316 0.62
317 0.53
318 0.45
319 0.35
320 0.28
321 0.25
322 0.22
323 0.18
324 0.15
325 0.14
326 0.14
327 0.14
328 0.12
329 0.09
330 0.08
331 0.08
332 0.07
333 0.06
334 0.07
335 0.1
336 0.14
337 0.18
338 0.18
339 0.21
340 0.23
341 0.23
342 0.25
343 0.26
344 0.24
345 0.21
346 0.24
347 0.23
348 0.22
349 0.2
350 0.17
351 0.12
352 0.1
353 0.09
354 0.05
355 0.04
356 0.04
357 0.04
358 0.05
359 0.05
360 0.06
361 0.06
362 0.07
363 0.07
364 0.07
365 0.06
366 0.06
367 0.06
368 0.06
369 0.06
370 0.06
371 0.05
372 0.05
373 0.05
374 0.06
375 0.05
376 0.05
377 0.05
378 0.04
379 0.05
380 0.05
381 0.05
382 0.05
383 0.06
384 0.07
385 0.08
386 0.11
387 0.11
388 0.12
389 0.12
390 0.16
391 0.24
392 0.28
393 0.34
394 0.39
395 0.41
396 0.47
397 0.53
398 0.52
399 0.5
400 0.51
401 0.49
402 0.53
403 0.59
404 0.52
405 0.47
406 0.46
407 0.4
408 0.34
409 0.29
410 0.19
411 0.11
412 0.11
413 0.11
414 0.09
415 0.08
416 0.08
417 0.08
418 0.07
419 0.1
420 0.1
421 0.1
422 0.11
423 0.11
424 0.11
425 0.18
426 0.22
427 0.23
428 0.26
429 0.3
430 0.3
431 0.33
432 0.4
433 0.41
434 0.38
435 0.35
436 0.39
437 0.35
438 0.39
439 0.4
440 0.4
441 0.34
442 0.35
443 0.39
444 0.42
445 0.46
446 0.51
447 0.58
448 0.61
449 0.69
450 0.75
451 0.78
452 0.76
453 0.78
454 0.75
455 0.75
456 0.72
457 0.7
458 0.7
459 0.71
460 0.66
461 0.61
462 0.56
463 0.46
464 0.41
465 0.36
466 0.29
467 0.25
468 0.27
469 0.32
470 0.39
471 0.41
472 0.42
473 0.42
474 0.49
475 0.54
476 0.55
477 0.57
478 0.59
479 0.64
480 0.67
481 0.72
482 0.72
483 0.71
484 0.73
485 0.71
486 0.69
487 0.67
488 0.69
489 0.66
490 0.59
491 0.54
492 0.48
493 0.41
494 0.35
495 0.33
496 0.34
497 0.34
498 0.32
499 0.3
500 0.29
501 0.29
502 0.31
503 0.28
504 0.21
505 0.17
506 0.22
507 0.22
508 0.2
509 0.2
510 0.18
511 0.19
512 0.17
513 0.16
514 0.12
515 0.13
516 0.13
517 0.13
518 0.12
519 0.15
520 0.16
521 0.16
522 0.17
523 0.16
524 0.18
525 0.2
526 0.24
527 0.21
528 0.21
529 0.23
530 0.22
531 0.26
532 0.26
533 0.27
534 0.25
535 0.27
536 0.29
537 0.32
538 0.3
539 0.28
540 0.33
541 0.3
542 0.33
543 0.37
544 0.41
545 0.4
546 0.4
547 0.39
548 0.35
549 0.34
550 0.26
551 0.2
552 0.13
553 0.12
554 0.13
555 0.13
556 0.11
557 0.11
558 0.14
559 0.16
560 0.2
561 0.26
562 0.29
563 0.36
564 0.45
565 0.54
566 0.58
567 0.62
568 0.63
569 0.63
570 0.7
571 0.72
572 0.73
573 0.72
574 0.76
575 0.81
576 0.84
577 0.86
578 0.85
579 0.85
580 0.82
581 0.78
582 0.75