Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166UM39

Protein Details
Accession A0A166UM39    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
140-167VAWYIRDRIQRRRRRQKRQFRTGLRAQSHydrophilic
NLS Segment(s)
PositionSequence
149-161QRRRRRQKRQFRT
Subcellular Location(s) nucl 18, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MAAHLPTFNFNPLAPVTPPPEHLSFRKPALPLSAQLKRKAAEANITNDHVTATMKKEESPTHNPSMAAPPKPTSMPNASAADPNQPPMDPRYVAMVSRIAAYYQQRCQAISNAQQQRCQAWANMHRQKCQEMMQAAMLVVAWYIRDRIQRRRRRQKRQFRTGLRAQSTRSRVTKGEGVRRWVMNVPEGLSSAHVPALDQLTDQDEAHFSMDKEVPPDKDAKLFEMADGMIRSQYRKIEVPILGVLGFEEDESESESEADDDFDQPMEDELEDGEVEEYEDDEDDLDLDDEDEEEEAGSEVVHRGTGTGTGSRGKDSGLSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.27
4 0.27
5 0.31
6 0.32
7 0.35
8 0.36
9 0.39
10 0.41
11 0.4
12 0.42
13 0.44
14 0.4
15 0.38
16 0.41
17 0.39
18 0.38
19 0.41
20 0.46
21 0.45
22 0.49
23 0.51
24 0.45
25 0.45
26 0.44
27 0.38
28 0.39
29 0.38
30 0.4
31 0.4
32 0.42
33 0.39
34 0.34
35 0.32
36 0.23
37 0.2
38 0.17
39 0.16
40 0.2
41 0.2
42 0.22
43 0.26
44 0.31
45 0.37
46 0.42
47 0.45
48 0.45
49 0.46
50 0.45
51 0.43
52 0.47
53 0.45
54 0.4
55 0.36
56 0.33
57 0.33
58 0.35
59 0.33
60 0.29
61 0.28
62 0.29
63 0.31
64 0.31
65 0.3
66 0.31
67 0.31
68 0.31
69 0.27
70 0.25
71 0.21
72 0.19
73 0.19
74 0.2
75 0.23
76 0.17
77 0.17
78 0.21
79 0.21
80 0.21
81 0.21
82 0.2
83 0.15
84 0.16
85 0.16
86 0.1
87 0.13
88 0.17
89 0.2
90 0.21
91 0.26
92 0.25
93 0.25
94 0.27
95 0.28
96 0.29
97 0.32
98 0.38
99 0.43
100 0.44
101 0.46
102 0.45
103 0.43
104 0.39
105 0.33
106 0.25
107 0.24
108 0.3
109 0.37
110 0.45
111 0.46
112 0.48
113 0.49
114 0.49
115 0.44
116 0.39
117 0.34
118 0.27
119 0.25
120 0.22
121 0.2
122 0.18
123 0.15
124 0.12
125 0.06
126 0.05
127 0.04
128 0.03
129 0.03
130 0.04
131 0.06
132 0.13
133 0.17
134 0.28
135 0.39
136 0.49
137 0.6
138 0.71
139 0.79
140 0.85
141 0.92
142 0.93
143 0.93
144 0.94
145 0.93
146 0.88
147 0.85
148 0.81
149 0.78
150 0.7
151 0.61
152 0.52
153 0.5
154 0.46
155 0.44
156 0.38
157 0.33
158 0.3
159 0.3
160 0.34
161 0.32
162 0.38
163 0.35
164 0.38
165 0.38
166 0.38
167 0.37
168 0.34
169 0.29
170 0.22
171 0.2
172 0.17
173 0.14
174 0.14
175 0.13
176 0.11
177 0.1
178 0.08
179 0.08
180 0.07
181 0.06
182 0.07
183 0.08
184 0.07
185 0.07
186 0.07
187 0.08
188 0.1
189 0.1
190 0.09
191 0.08
192 0.09
193 0.1
194 0.11
195 0.09
196 0.12
197 0.14
198 0.14
199 0.16
200 0.19
201 0.19
202 0.19
203 0.22
204 0.19
205 0.23
206 0.23
207 0.22
208 0.23
209 0.22
210 0.2
211 0.19
212 0.18
213 0.14
214 0.14
215 0.12
216 0.1
217 0.1
218 0.12
219 0.13
220 0.15
221 0.17
222 0.19
223 0.21
224 0.26
225 0.26
226 0.27
227 0.25
228 0.23
229 0.2
230 0.17
231 0.15
232 0.09
233 0.08
234 0.05
235 0.05
236 0.05
237 0.05
238 0.08
239 0.08
240 0.08
241 0.08
242 0.08
243 0.08
244 0.08
245 0.09
246 0.08
247 0.08
248 0.08
249 0.09
250 0.09
251 0.08
252 0.09
253 0.09
254 0.08
255 0.07
256 0.07
257 0.07
258 0.07
259 0.07
260 0.07
261 0.06
262 0.06
263 0.06
264 0.06
265 0.06
266 0.06
267 0.06
268 0.06
269 0.06
270 0.06
271 0.06
272 0.06
273 0.06
274 0.06
275 0.06
276 0.06
277 0.06
278 0.06
279 0.06
280 0.05
281 0.06
282 0.05
283 0.05
284 0.05
285 0.06
286 0.07
287 0.07
288 0.07
289 0.07
290 0.07
291 0.08
292 0.1
293 0.12
294 0.13
295 0.15
296 0.21
297 0.22
298 0.24
299 0.23
300 0.22