Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A166RDW2

Protein Details
Accession A0A166RDW2   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
127-151VELERNPDSRRARRARRHVDEEICFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5cyto_nucl 12.5, cyto 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013830  SGNH_hydro  
IPR036514  SGNH_hydro_sf  
Gene Ontology GO:0016787  F:hydrolase activity  
Pfam View protein in Pfam  
PF13472  Lipase_GDSL_2  
CDD cd00229  SGNH_hydrolase  
Amino Acid Sequences SQTTYDWVIVLGGTNDLAYNVPPERIFESLRRVYDSAIAKGGKVLALTVPECAVKDDELDSRRRRLNNTILSHQSPNYHAFDLNPRIPYHSLTERERQRYWDDGLHLTAAGYDWMGTHVAEALGDLVELERNPDSRRARRARRHVDEEICFNEEDGDPRSLSGGYVVVRMRDLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.07
5 0.06
6 0.09
7 0.1
8 0.12
9 0.12
10 0.15
11 0.17
12 0.19
13 0.22
14 0.22
15 0.29
16 0.33
17 0.34
18 0.36
19 0.34
20 0.32
21 0.35
22 0.35
23 0.29
24 0.28
25 0.27
26 0.22
27 0.23
28 0.22
29 0.16
30 0.12
31 0.11
32 0.07
33 0.09
34 0.1
35 0.09
36 0.1
37 0.09
38 0.1
39 0.11
40 0.11
41 0.08
42 0.09
43 0.1
44 0.14
45 0.17
46 0.23
47 0.25
48 0.29
49 0.34
50 0.36
51 0.37
52 0.39
53 0.46
54 0.48
55 0.5
56 0.5
57 0.5
58 0.5
59 0.48
60 0.42
61 0.34
62 0.28
63 0.26
64 0.23
65 0.19
66 0.16
67 0.16
68 0.21
69 0.24
70 0.24
71 0.23
72 0.21
73 0.22
74 0.23
75 0.24
76 0.22
77 0.22
78 0.24
79 0.26
80 0.34
81 0.37
82 0.42
83 0.42
84 0.41
85 0.38
86 0.37
87 0.37
88 0.32
89 0.28
90 0.24
91 0.24
92 0.21
93 0.18
94 0.14
95 0.12
96 0.08
97 0.06
98 0.04
99 0.03
100 0.03
101 0.04
102 0.05
103 0.04
104 0.04
105 0.05
106 0.05
107 0.05
108 0.05
109 0.04
110 0.04
111 0.04
112 0.04
113 0.03
114 0.04
115 0.04
116 0.06
117 0.07
118 0.09
119 0.11
120 0.19
121 0.27
122 0.33
123 0.44
124 0.52
125 0.62
126 0.71
127 0.8
128 0.83
129 0.85
130 0.86
131 0.83
132 0.81
133 0.74
134 0.69
135 0.61
136 0.52
137 0.43
138 0.35
139 0.29
140 0.22
141 0.21
142 0.19
143 0.18
144 0.16
145 0.16
146 0.17
147 0.15
148 0.14
149 0.13
150 0.12
151 0.1
152 0.15
153 0.16
154 0.16