Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166V8L1

Protein Details
Accession A0A166V8L1    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
9-32LNLVKRREMSRRTRPREPIKDVSQHydrophilic
NLS Segment(s)
PositionSequence
14-46RREMSRRTRPREPIKDVSQASPAHRRPGHGRKP
Subcellular Location(s) mito 24, nucl 3
Family & Domain DBs
Amino Acid Sequences MACLIRNALNLVKRREMSRRTRPREPIKDVSQASPAHRRPGHGRKPGHVPEGDALLAPRLMGTTPRTVGKKTPHGFQVAQSPSPIKCGGMSLSRLHMLAKPKMRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.5
3 0.54
4 0.58
5 0.62
6 0.68
7 0.7
8 0.77
9 0.83
10 0.85
11 0.86
12 0.84
13 0.81
14 0.75
15 0.75
16 0.68
17 0.6
18 0.54
19 0.47
20 0.42
21 0.43
22 0.39
23 0.39
24 0.38
25 0.39
26 0.43
27 0.51
28 0.57
29 0.56
30 0.57
31 0.52
32 0.6
33 0.61
34 0.55
35 0.45
36 0.37
37 0.29
38 0.28
39 0.24
40 0.15
41 0.12
42 0.08
43 0.07
44 0.06
45 0.05
46 0.03
47 0.03
48 0.05
49 0.08
50 0.1
51 0.12
52 0.16
53 0.18
54 0.19
55 0.24
56 0.3
57 0.38
58 0.37
59 0.4
60 0.4
61 0.43
62 0.42
63 0.39
64 0.42
65 0.35
66 0.33
67 0.3
68 0.29
69 0.25
70 0.28
71 0.26
72 0.17
73 0.14
74 0.15
75 0.17
76 0.19
77 0.22
78 0.21
79 0.24
80 0.24
81 0.24
82 0.24
83 0.25
84 0.27
85 0.33