Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G2WT01

Protein Details
Accession G2WT01    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
132-153AGPSSKKPQKKMPPPEIPKSSPHydrophilic
NLS Segment(s)
PositionSequence
134-158PSSKKPQKKMPPPEIPKSSPPKPKP
Subcellular Location(s) cyto 14, cyto_nucl 11.5, pero 6, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015940  UBA  
IPR009060  UBA-like_sf  
KEGG vda:VDAG_00924  -  
Pfam View protein in Pfam  
PF00627  UBA  
PROSITE View protein in PROSITE  
PS50030  UBA  
CDD cd14270  UBA  
Amino Acid Sequences MSSDELEKISQPEYFQRLKQLQGMGFGNDAAADALHEANFDVELAVQYLTDGNPFRMDLDKGTAAADFLAEPPFLSLEAVLDGAPLEKHESYIHAGASVTAPTRCKCPGTGRERENDDEDVIRQIKEDKWAAGPSSKKPQKKMPPPEIPKSSPPKPKPEQLRDLRVGIIGAGFTGLLLAHGLRRHGGIEVDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.38
4 0.4
5 0.41
6 0.45
7 0.43
8 0.38
9 0.39
10 0.39
11 0.31
12 0.28
13 0.25
14 0.2
15 0.14
16 0.13
17 0.07
18 0.05
19 0.04
20 0.05
21 0.05
22 0.05
23 0.06
24 0.05
25 0.06
26 0.06
27 0.05
28 0.05
29 0.04
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.05
37 0.08
38 0.09
39 0.09
40 0.1
41 0.1
42 0.11
43 0.13
44 0.14
45 0.12
46 0.15
47 0.15
48 0.14
49 0.15
50 0.13
51 0.11
52 0.1
53 0.09
54 0.05
55 0.05
56 0.06
57 0.05
58 0.05
59 0.06
60 0.06
61 0.06
62 0.05
63 0.04
64 0.04
65 0.04
66 0.05
67 0.04
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.06
74 0.06
75 0.07
76 0.07
77 0.09
78 0.1
79 0.12
80 0.11
81 0.09
82 0.09
83 0.09
84 0.09
85 0.08
86 0.07
87 0.07
88 0.08
89 0.08
90 0.11
91 0.12
92 0.13
93 0.15
94 0.22
95 0.3
96 0.36
97 0.44
98 0.45
99 0.49
100 0.52
101 0.52
102 0.48
103 0.39
104 0.33
105 0.25
106 0.22
107 0.21
108 0.18
109 0.15
110 0.13
111 0.14
112 0.14
113 0.19
114 0.19
115 0.16
116 0.18
117 0.2
118 0.21
119 0.24
120 0.26
121 0.26
122 0.36
123 0.42
124 0.44
125 0.47
126 0.56
127 0.62
128 0.69
129 0.75
130 0.74
131 0.78
132 0.81
133 0.86
134 0.83
135 0.76
136 0.74
137 0.72
138 0.7
139 0.69
140 0.67
141 0.68
142 0.66
143 0.71
144 0.73
145 0.74
146 0.76
147 0.74
148 0.78
149 0.72
150 0.68
151 0.6
152 0.49
153 0.4
154 0.3
155 0.21
156 0.12
157 0.08
158 0.06
159 0.05
160 0.04
161 0.04
162 0.03
163 0.03
164 0.04
165 0.04
166 0.07
167 0.09
168 0.11
169 0.12
170 0.13
171 0.13
172 0.15