Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A166VEL4

Protein Details
Accession A0A166VEL4    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
196-215SGFGGSGGKKKKNKKAEGEEBasic
NLS Segment(s)
PositionSequence
202-211GGKKKKNKKA
Subcellular Location(s) mito 12.5, mito_nucl 12.166, nucl 10.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR046522  DUF6699  
Pfam View protein in Pfam  
PF20415  DUF6699  
Amino Acid Sequences LHPTTPPTVHPTTKHHLFITRQSNFRSPRSNKPQPIAIMTEPLSKVDSAVGGLSQSPPKEHKTRRQSSAAAPGVYNIKDLEEQKIELELAPETQRTGWKINTSSSTVEDKDILKLPLSKPPVKKIDLHFPLGMEVTARNLKGVTIKDALDAIHKAYKKRADDELDKPYLAGFEWDKEESWTRLVVHLQKQPATGGSGFGGSGGKKKKNKKAEGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.51
3 0.52
4 0.51
5 0.55
6 0.58
7 0.56
8 0.54
9 0.54
10 0.6
11 0.58
12 0.6
13 0.61
14 0.56
15 0.61
16 0.67
17 0.73
18 0.71
19 0.7
20 0.71
21 0.64
22 0.62
23 0.56
24 0.47
25 0.41
26 0.35
27 0.36
28 0.29
29 0.27
30 0.24
31 0.18
32 0.17
33 0.13
34 0.12
35 0.08
36 0.08
37 0.07
38 0.06
39 0.07
40 0.09
41 0.11
42 0.11
43 0.13
44 0.16
45 0.21
46 0.31
47 0.38
48 0.46
49 0.55
50 0.62
51 0.66
52 0.69
53 0.67
54 0.62
55 0.64
56 0.58
57 0.48
58 0.39
59 0.34
60 0.31
61 0.28
62 0.24
63 0.13
64 0.11
65 0.13
66 0.14
67 0.16
68 0.14
69 0.14
70 0.14
71 0.15
72 0.14
73 0.11
74 0.11
75 0.07
76 0.08
77 0.08
78 0.08
79 0.07
80 0.08
81 0.1
82 0.11
83 0.14
84 0.14
85 0.17
86 0.18
87 0.2
88 0.21
89 0.22
90 0.2
91 0.2
92 0.21
93 0.19
94 0.18
95 0.17
96 0.15
97 0.15
98 0.16
99 0.14
100 0.12
101 0.15
102 0.15
103 0.2
104 0.25
105 0.28
106 0.29
107 0.36
108 0.4
109 0.39
110 0.43
111 0.41
112 0.46
113 0.44
114 0.45
115 0.38
116 0.33
117 0.32
118 0.27
119 0.23
120 0.12
121 0.09
122 0.08
123 0.1
124 0.1
125 0.09
126 0.09
127 0.1
128 0.13
129 0.15
130 0.16
131 0.16
132 0.16
133 0.16
134 0.17
135 0.17
136 0.15
137 0.14
138 0.13
139 0.15
140 0.17
141 0.18
142 0.24
143 0.31
144 0.32
145 0.35
146 0.4
147 0.42
148 0.46
149 0.51
150 0.53
151 0.49
152 0.45
153 0.41
154 0.34
155 0.28
156 0.21
157 0.18
158 0.11
159 0.11
160 0.15
161 0.16
162 0.16
163 0.19
164 0.22
165 0.21
166 0.21
167 0.21
168 0.19
169 0.2
170 0.26
171 0.3
172 0.33
173 0.37
174 0.4
175 0.4
176 0.4
177 0.39
178 0.34
179 0.31
180 0.24
181 0.2
182 0.16
183 0.14
184 0.13
185 0.13
186 0.13
187 0.1
188 0.17
189 0.23
190 0.32
191 0.39
192 0.5
193 0.59
194 0.68
195 0.78